PDB entry 4e7n

View 4e7n on RCSB PDB site
Description: Crystal Structure of AhV_TL-I, a Glycosylated Snake-venom Thrombin-like Enzyme from Agkistrodon halys
Class: Hydrolase
Keywords: Beta-Barrel, Hydrolase, Arginine Esterase, Glycosylation, Extracellular
Deposited on 2012-03-18, released 2012-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.179
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Snake-venom Thrombin-like Enzyme
  Species: Agkistrodon halys [TaxId:8714]
  Database cross-references and differences (RAF-indexed):
  • PDB 4E7N (0-230)
  Domains in SCOPe 2.07: d4e7na_
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4e7nA (A:)
  iiggdecninehrflvalytsrsrtlfcggtlinqewvltaahcdrknfriklgmhskkv
  pnedeqtrvpkekffclssknytlwdkdimlirldspvknskhiapfslpssppsvgsvc
  rimgwgrisptegtypdvphcvninlleyemcrapypefelpatsrtlcagileggkdtc
  kgdsggplicngqfqgiaswgddpcaqphkpaaytkvfdhldwieniiagntdascpp