PDB entry 4e74

View 4e74 on RCSB PDB site
Description: Crystal structure of the RHO GTPASE BINDING DOMAIN of Plexin A4A
Class: signaling protein
Keywords: plexin, rbd, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2012-03-16, released 2012-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.204
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plexin-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: PLXNA4, KIAA1550, PLXNA4A, PLXNA4B, UNQ2820/PRO34003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e74a_
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e74A (A:)
    gdklirqqidyktlvlscvspdnanspevpvkilncdtitqvkekildaifknvpcshrp
    kaadmdlewrqgsgarmilqdedittkiendwkrlntlahyqvpdgsvvalvskqvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e74A (A:)
    dyktlvlscvspspevpvkilncdtitqvkekildaifknvpcshrpkaadmdlewrqgs
    garmilqdedittkiwkrlntlahyqvpdgsvvalvskqvt