PDB entry 4e5u

View 4e5u on RCSB PDB site
Description: The crystal structure of thymidylate kinase from Pseudomonas aeruginosa PAO1 in complex with thymidine monophosphate.
Class: transferase
Keywords: structural genomics, PSI-Biology, protein structure initiative, midwest center for structural genomics, MCSG, Structures of Mtb Proteins Conferring Susceptibility to Known Mtb Inhibitors, MTBI, TRANSFERASE
Deposited on 2012-03-14, released 2012-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.191
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA2962, tmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e5ua_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA2962, tmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e5ub_
  • Heterogens: TMP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e5uA (A:)
    snamtglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllaps
    depmaadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpearia
    alesfvqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqa
    peryqvldaglplaevqagldrllpnllerlng
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e5uA (A:)
    tglfvtlegpestnrdylaerlrergievqltrepggtplaerirelllapsdepmaadt
    elllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaalesfvqg
    dlrpdltlvfdlpveiglaraaarrldrfeqedrrffeavrqtylqraaqaperyqvlda
    glplaevqagldrllpnllerlng
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e5uB (B:)
    snamtglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllaps
    depmaadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpearia
    alesfvqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqa
    peryqvldaglplaevqagldrllpnllerlng
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e5uB (B:)
    tglfvtlegpegastnrdylaerlrergievqltrepggtplaerirelllapsdepmaa
    dtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaalesfv
    qgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqaperyqv
    ldaglplaevqagldrllpnllerln