PDB entry 4e5b

View 4e5b on RCSB PDB site
Description: Structure of p38a MAP kinase without BOG
Class: transferase
Keywords: MAP kinase, p38, signal transduction, alternative activation modes, Kinase topology, Kinase, substrates, phosphorylation, TRANSFERASE
Deposited on 2012-03-14, released 2012-10-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.236
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4e5ba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e5bA (A:)
    msqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e5bA (A:)
    erptfyrqelktiwevperyqnlspvgsgsvcaafdtktglrvavkklsrpfqsiihakr
    tyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnqkltddhvqfli
    yqilrglkyihsadiihrdlkpsnlavnedcelkildfrwyrapeimlnwmhynqtvdiw
    svgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqmpk
    mnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqsf
    esrdllidewksltydevisfvpp