PDB entry 4e4p

View 4e4p on RCSB PDB site
Description: Second native structure of Xylanase A1 from Paenibacillus sp. JDR-2
Class: hydrolase
Keywords: xylanase, Paenibacillus, TIM barrel, beta/alpha 8 fold, HYDROLASE
Deposited on 2012-03-13, released 2012-04-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.256
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase A
    Species: Paenibacillus sp. [TaxId:324057]
    Gene: Pjdr2_0221, xynA, xynA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e4pa_
  • Chain 'B':
    Compound: Endo-1,4-beta-xylanase A
    Species: Paenibacillus sp. [TaxId:324057]
    Gene: Pjdr2_0221, xynA, xynA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e4pb_
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e4pA (A:)
    gshmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnft
    ftaadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiq
    tvmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevld
    enpswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintn
    pdnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhia
    rvtfwgmddntswraennpllfdknlqakpayygvidpaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e4pA (A:)
    aplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnftftaa
    damidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiqtvmk
    hfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevldenps
    wniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintnpdnv
    klslekfislgvevsvseldvtaglavgqaylyaqlfklykehadhiarvtfw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e4pB (B:)
    gshmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnft
    ftaadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiq
    tvmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevld
    enpswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintn
    pdnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhia
    rvtfwgmddntswraennpllfdknlqakpayygvidpaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e4pB (B:)
    aplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnftftaa
    damidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiqtvmk
    hfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevldenps
    wniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintnpdnv
    klslekfislgvevsvseldvtaglavgqaylyaqlfklykehadhiarvtfw