PDB entry 4e4f

View 4e4f on RCSB PDB site
Description: Crystal structure of enolase PC1_0802 (TARGET EFI-502240) from Pectobacterium carotovorum subsp. carotovorum PC1
Class: isomerase
Keywords: dehydratase, magnesium binding, enzyme function initiative, enolase, isomerase
Deposited on 2012-03-12, released 2012-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mannonate dehydratase
    Species: Pectobacterium carotovorum subsp. carotovorum [TaxId:561230]
    Gene: PC1_0802
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6D9S0 (22-425)
      • expression tag (21)
    Domains in SCOPe 2.07: d4e4fa1, d4e4fa2, d4e4fa3
  • Chain 'B':
    Compound: Mannonate dehydratase
    Species: Pectobacterium carotovorum subsp. carotovorum [TaxId:561230]
    Gene: PC1_0802
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6D9S0 (22-425)
      • expression tag (21)
    Domains in SCOPe 2.07: d4e4fb1, d4e4fb2, d4e4fb3
  • Chain 'C':
    Compound: Mannonate dehydratase
    Species: Pectobacterium carotovorum subsp. carotovorum [TaxId:561230]
    Gene: PC1_0802
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6D9S0 (22-425)
      • expression tag (20-21)
    Domains in SCOPe 2.07: d4e4fc1, d4e4fc2, d4e4fc3
  • Chain 'D':
    Compound: Mannonate dehydratase
    Species: Pectobacterium carotovorum subsp. carotovorum [TaxId:561230]
    Gene: PC1_0802
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6D9S0 (22-425)
      • expression tag (19-21)
    Domains in SCOPe 2.07: d4e4fd1, d4e4fd2, d4e4fd3
  • Heterogens: GOL, CL, MG, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e4fA (A:)
    mhhhhhhssgvdlgtenlyfqsmkivsaevfvtcpgrnfvtlkittdsgltglgdatlng
    relpvasylndhvcpqligrdahqiediwqyfykgaywrrgpvtmsaisavdmalwdika
    kaanmplyqllggasrtgvmvychttghsidevlddyakhrdqgfkairvqcgvpgmett
    ygmakgkglayepatkgslpeeqlwstekyldftpklfeavrdkfgfnehllhdmhhrlt
    pieaarfgksvedyrlfwmedptpaenqacfrlirqhtvtpiavgevfnsiwdckqliee
    qlidyirttithaggitgmrriadfaslyqvrtgshgpsdlspicmaaalhfdlwvpnfg
    vqeymgyseqmlevfphswtfdngymhpgekpglgiefdeklaakypydpaylpvarled
    gtlwnw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e4fA (A:)
    smkivsaevfvtcpgrnfvtlkittdsgltglgdatlngrelpvasylndhvcpqligrd
    ahqiediwqyfykgaywrrgpvtmsaisavdmalwdikakaanmplyqllggasrtgvmv
    ychttghsidevlddyakhrdqgfkairvqcepatkgslpeeqlwstekyldftpklfea
    vrdkfgfnehllhdmhhrltpieaarfgksvedyrlfwmedptpaenqacfrlirqhtvt
    piavgevfnsiwdckqlieeqlidyirttithaggitgmrriadfaslyqvrtgshgpsd
    lspicmaaalhfdlwvpnfgvqeymgyseqmlevfphswtfdngymhpgekpglgiefde
    klaakypydpaylpvarledgtlwnw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e4fB (B:)
    mhhhhhhssgvdlgtenlyfqsmkivsaevfvtcpgrnfvtlkittdsgltglgdatlng
    relpvasylndhvcpqligrdahqiediwqyfykgaywrrgpvtmsaisavdmalwdika
    kaanmplyqllggasrtgvmvychttghsidevlddyakhrdqgfkairvqcgvpgmett
    ygmakgkglayepatkgslpeeqlwstekyldftpklfeavrdkfgfnehllhdmhhrlt
    pieaarfgksvedyrlfwmedptpaenqacfrlirqhtvtpiavgevfnsiwdckqliee
    qlidyirttithaggitgmrriadfaslyqvrtgshgpsdlspicmaaalhfdlwvpnfg
    vqeymgyseqmlevfphswtfdngymhpgekpglgiefdeklaakypydpaylpvarled
    gtlwnw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e4fB (B:)
    smkivsaevfvtcpgrnfvtlkittdsgltglgdatlngrelpvasylndhvcpqligrd
    ahqiediwqyfykgaywrrgpvtmsaisavdmalwdikakaanmplyqllggasrtgvmv
    ychttghsidevlddyakhrdqgfkairvqcgslpeeqlwstekyldftpklfeavrdkf
    gfnehllhdmhhrltpieaarfgksvedyrlfwmedptpaenqacfrlirqhtvtpiavg
    evfnsiwdckqlieeqlidyirttithaggitgmrriadfaslyqvrtgshgpsdlspic
    maaalhfdlwvpnfgvqeymgyseqmlevfphswtfdngymhpgekpglgiefdeklaak
    ypydpaylpvarledgtlwnw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4e4fC (C:)
    mhhhhhhssgvdlgtenlyfqsmkivsaevfvtcpgrnfvtlkittdsgltglgdatlng
    relpvasylndhvcpqligrdahqiediwqyfykgaywrrgpvtmsaisavdmalwdika
    kaanmplyqllggasrtgvmvychttghsidevlddyakhrdqgfkairvqcgvpgmett
    ygmakgkglayepatkgslpeeqlwstekyldftpklfeavrdkfgfnehllhdmhhrlt
    pieaarfgksvedyrlfwmedptpaenqacfrlirqhtvtpiavgevfnsiwdckqliee
    qlidyirttithaggitgmrriadfaslyqvrtgshgpsdlspicmaaalhfdlwvpnfg
    vqeymgyseqmlevfphswtfdngymhpgekpglgiefdeklaakypydpaylpvarled
    gtlwnw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e4fC (C:)
    qsmkivsaevfvtcpgrnfvtlkittdsgltglgdatlngrelpvasylndhvcpqligr
    dahqiediwqyfykgaywrrgpvtmsaisavdmalwdikakaanmplyqllggasrtgvm
    vychttghsidevlddyakhrdqgfkairvqcslpeeqlwstekyldftpklfeavrdkf
    gfnehllhdmhhrltpieaarfgksvedyrlfwmedptpaenqacfrlirqhtvtpiavg
    evfnsiwdckqlieeqlidyirttithaggitgmrriadfaslyqvrtgshgpsdlspic
    maaalhfdlwvpnfgvqeymgyseqmlevfphswtfdngymhpgekpglgiefdeklaak
    ypydpaylpvarledgtlwnw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4e4fD (D:)
    mhhhhhhssgvdlgtenlyfqsmkivsaevfvtcpgrnfvtlkittdsgltglgdatlng
    relpvasylndhvcpqligrdahqiediwqyfykgaywrrgpvtmsaisavdmalwdika
    kaanmplyqllggasrtgvmvychttghsidevlddyakhrdqgfkairvqcgvpgmett
    ygmakgkglayepatkgslpeeqlwstekyldftpklfeavrdkfgfnehllhdmhhrlt
    pieaarfgksvedyrlfwmedptpaenqacfrlirqhtvtpiavgevfnsiwdckqliee
    qlidyirttithaggitgmrriadfaslyqvrtgshgpsdlspicmaaalhfdlwvpnfg
    vqeymgyseqmlevfphswtfdngymhpgekpglgiefdeklaakypydpaylpvarled
    gtlwnw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e4fD (D:)
    fqsmkivsaevfvtcpgrnfvtlkittdsgltglgdatlngrelpvasylndhvcpqlig
    rdahqiediwqyfykgaywrrgpvtmsaisavdmalwdikakaanmplyqllggasrtgv
    mvychttghsidevlddyakhrdqgfkairvqcepatkgslpeeqlwstekyldftpklf
    eavrdkfgfnehllhdmhhrltpieaarfgksvedyrlfwmedptpaenqacfrlirqht
    vtpiavgevfnsiwdckqlieeqlidyirttithaggitgmrriadfaslyqvrtgshgp
    sdlspicmaaalhfdlwvpnfgvqeymgyseqmlevfphswtfdngymhpgekpglgief
    deklaakypydpaylpvarledgtlwnw