PDB entry 4e4e

View 4e4e on RCSB PDB site
Description: Crystal Structure of the Y34F mutant of Saccharomyces cerevisiae Manganese Superoxide Dismutase
Class: oxidoreductase
Keywords: Mn Superoxide Dismutase, OXIDOREDUCTASE
Deposited on 2012-03-12, released 2012-08-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.192
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SOD2, YHR008C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00447 (0-End)
      • engineered mutation (33)
    Domains in SCOPe 2.04: d4e4ea1, d4e4ea2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SOD2, YHR008C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00447 (0-206)
      • engineered mutation (33)
    Domains in SCOPe 2.04: d4e4eb1, d4e4eb2
  • Chain 'C':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SOD2, YHR008C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00447 (0-End)
      • engineered mutation (33)
    Domains in SCOPe 2.04: d4e4ec1, d4e4ec2
  • Chain 'D':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SOD2, YHR008C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00447 (0-End)
      • engineered mutation (33)
    Domains in SCOPe 2.04: d4e4ed1, d4e4ed2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e4eA (A:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtfvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    kkadyfkaiwnvvnwkeasrrfdagki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e4eA (A:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtfvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    kkadyfkaiwnvvnwkeasrrfdagk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4e4eB (B:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtfvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    kkadyfkaiwnvvnwkeasrrfdagki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4e4eC (C:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtfvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    kkadyfkaiwnvvnwkeasrrfdagki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e4eC (C:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtfvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    kkadyfkaiwnvvnwkeasrrfdag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4e4eD (D:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtfvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    kkadyfkaiwnvvnwkeasrrfdagki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e4eD (D:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtfvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    kkadyfkaiwnvvnwkeasrrfd