PDB entry 4e43

View 4e43 on RCSB PDB site
Description: HIV protease (PR) dimer with acetate in exo site and peptide in active site
Class: hydrolase
Keywords: HIV-1 protease, exo site, aspartyl protease, fragment screen, HYDROLASE
Deposited on 2012-03-11, released 2012-05-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.195
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q903N5 (0-98)
      • engineered mutation (6)
    Domains in SCOPe 2.06: d4e43a_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q903N5 (0-98)
      • engineered mutation (6)
    Domains in SCOPe 2.06: d4e43b_
  • Chain 'C':
    Compound: Random peptide
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 4E43 (0-5)
  • Heterogens: DMS, ACT, GOL, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4e43A (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4e43B (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'C':
    No sequence available.