PDB entry 4e43
View 4e43 on RCSB PDB site
Description: HIV protease (PR) dimer with acetate in exo site and peptide in active site
Class: hydrolase
Keywords: HIV-1 protease, exo site, aspartyl protease, fragment screen, HYDROLASE
Deposited on
2012-03-11, released
2012-05-30
The last revision prior to the SCOPe 2.06 freeze date was dated
2012-06-06, with a file datestamp of
2012-06-01.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.195
AEROSPACI score: 0.61
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d4e43a_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d4e43b_ - Chain 'C':
Compound: Random peptide
Species: unidentified [TaxId:32644]
Database cross-references and differences (RAF-indexed):
- Heterogens: DMS, ACT, GOL, BME, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4e43A (A:)
pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4e43B (B:)
pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'C':
No sequence available.