PDB entry 4e42

View 4e42 on RCSB PDB site
Description: Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4
Class: immune system
Keywords: Ig domain, adaptive immunity, T cell receptor, MHC, IMMUNE SYSTEM
Deposited on 2012-03-11, released 2012-08-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.203
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T cell receptor G4 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4E42 (0-End)
    Domains in SCOPe 2.04: d4e42a1, d4e42a2
  • Chain 'B':
    Compound: T cell receptor G4 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4E42
    Domains in SCOPe 2.04: d4e42b1, d4e42b2
  • Chain 'C':
    Compound: T cell receptor G4 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4E42 (0-End)
    Domains in SCOPe 2.04: d4e42c1, d4e42c2
  • Chain 'D':
    Compound: T cell receptor G4 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4E42
    Domains in SCOPe 2.04: d4e42d1, d4e42d2
  • Heterogens: CL, NO3, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e42A (A:)
    iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
    ttvaterysllyisssqttdsgvyfcavdrgstlgrlyfgrgtqltvwpdiqkpdpavyq
    lrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e42A (A:)
    iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
    ttvaterysllyisssqttdsgvyfcavdgrlyfgrgtqltvwpdiqkpdpavyqlrdsv
    clftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfacanafnnsii
    pedtffp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e42B (B:)
    gvtqspthliktrgqqatlrcspisghtsvywyqqalglglqfllwydegeernrgnfpp
    rfsgrqfpnysselnvnaleledsalylcassqiretqyfgpgtrllvledlknvfppev
    avfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpalnd
    sryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e42B (B:)
    vtqspthliktrgqqatlrcspisghtsvywyqqalglglqfllwydegeernrgnfppr
    fsgrqfpnysselnvnaleledsalylcassetqyfgpgtrllvledlknvfppevavfe
    pseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpasryalss
    rlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4e42C (C:)
    iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
    ttvaterysllyisssqttdsgvyfcavdrgstlgrlyfgrgtqltvwpdiqkpdpavyq
    lrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e42C (C:)
    iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
    ttvaterysllyisssqttdsgvyfcavdrlyfgrgtqltvwpdiqkpdpavyqlrsvcl
    ftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnfacanafnnsiipedtf
    fp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4e42D (D:)
    gvtqspthliktrgqqatlrcspisghtsvywyqqalglglqfllwydegeernrgnfpp
    rfsgrqfpnysselnvnaleledsalylcassqiretqyfgpgtrllvledlknvfppev
    avfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpalnd
    sryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e42D (D:)
    vtqspthliktrgqqatlrcspisghtsvywyqqalglglqfllwydegeernrgnfppr
    fsgrqfpnysselnvnaleledsalylcassetqyfgpgtrllvledlknvfppevavfe
    pseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqsryalssrl
    rvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra