PDB entry 4e3x

View 4e3x on RCSB PDB site
Description: Crystal Structure of Mus musculus 1-pyrroline-5-carboxylate dehydrogenase cryoprotected in proline
Class: oxidoreductase
Keywords: Amino Acid Metabolism, Proline Inhibition, OXIDOREDUCTASE
Deposited on 2012-03-10, released 2012-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: 0.156
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: Aldh4a1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CHT0 (21-End)
      • expression tag (19-20)
      • conflict (32)
      • conflict (60)
      • conflict (467)
    Domains in SCOPe 2.07: d4e3xa1, d4e3xa2
  • Chain 'B':
    Compound: Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: Aldh4a1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CHT0 (21-562)
      • expression tag (17-20)
      • conflict (32)
      • conflict (60)
      • conflict (467)
    Domains in SCOPe 2.07: d4e3xb1, d4e3xb2
  • Heterogens: PRO, 16P, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e3xA (A:)
    mgsshhhhhhssglvprgshmlrwkhtsslkvanepilafsqgsperdalqkalkdlkgq
    teaipcvvgdeevwtsdiqyqlspfnhahkvakfcyadkallnraidaalaarkewdlkp
    madraqvflkaadmlsgprraevlaktmvgqgktviqaeidaaaelidffrfnakfavel
    egeqpisvppstnhtvyrglegfvaaispfnftaiggnlagapalmgnvvlwkpsdtaml
    asyavyrilreaglppniiqfvpadgptfgdtvtssehlcginftgsvptfkhlwrqvaq
    nldrfrtfprlagecggknfhfvhssadvdsvvsgtlrsafeyggqkcsacsrlyvpksl
    wpqikgrlleehsrikvgdpaedfgtffsavidakafarikkwleharsspslsilaggq
    cnesvgyyvepciieskdpqepimkeeifgpvltvyvypddkyretlklvdsttsygltg
    avfaqdkaivqeatrmlrnaagnfyindkstgsvvgqqpfggarasgtndkpggphyilr
    wtspqvikethkplgdwrysymq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e3xA (A:)
    hmlrwkhtsslkvanepilafsqgsperdalqkalkdlkgqteaipcvvgdeevwtsdiq
    yqlspfnhahkvakfcyadkallnraidaalaarkewdlkpmadraqvflkaadmlsgpr
    raevlaktmvgqgktviqaeidaaaelidffrfnakfavelegeqpisvppstnhtvyrg
    legfvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppnii
    qfvpadgptfgdtvtssehlcginftgsvptfkhlwrqvaqnldrfrtfprlagecggkn
    fhfvhssadvdsvvsgtlrsafeyggqkcsacsrlyvpkslwpqikgrlleehsrikvgd
    paedfgtffsavidakafarikkwleharsspslsilaggqcnesvgyyvepciieskdp
    qepimkeeifgpvltvyvypddkyretlklvdsttsygltgavfaqdkaivqeatrmlrn
    aagnfyindkstgsvvgqqpfggarasgtndkpggphyilrwtspqvikethkplgdwry
    sym
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e3xB (B:)
    mgsshhhhhhssglvprgshmlrwkhtsslkvanepilafsqgsperdalqkalkdlkgq
    teaipcvvgdeevwtsdiqyqlspfnhahkvakfcyadkallnraidaalaarkewdlkp
    madraqvflkaadmlsgprraevlaktmvgqgktviqaeidaaaelidffrfnakfavel
    egeqpisvppstnhtvyrglegfvaaispfnftaiggnlagapalmgnvvlwkpsdtaml
    asyavyrilreaglppniiqfvpadgptfgdtvtssehlcginftgsvptfkhlwrqvaq
    nldrfrtfprlagecggknfhfvhssadvdsvvsgtlrsafeyggqkcsacsrlyvpksl
    wpqikgrlleehsrikvgdpaedfgtffsavidakafarikkwleharsspslsilaggq
    cnesvgyyvepciieskdpqepimkeeifgpvltvyvypddkyretlklvdsttsygltg
    avfaqdkaivqeatrmlrnaagnfyindkstgsvvgqqpfggarasgtndkpggphyilr
    wtspqvikethkplgdwrysymq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e3xB (B:)
    gshmlrwkhtsslkvanepilafsqgsperdalqkalkdlkgqteaipcvvgdeevwtsd
    iqyqlspfnhahkvakfcyadkallnraidaalaarkewdlkpmadraqvflkaadmlsg
    prraevlaktmvgqgktviqaeidaaaelidffrfnakfavelegeqpisvppstnhtvy
    rglegfvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppn
    iiqfvpadgptfgdtvtssehlcginftgsvptfkhlwrqvaqnldrfrtfprlagecgg
    knfhfvhssadvdsvvsgtlrsafeyggqkcsacsrlyvpkslwpqikgrlleehsrikv
    gdpaedfgtffsavidakafarikkwleharsspslsilaggqcnesvgyyvepciiesk
    dpqepimkeeifgpvltvyvypddkyretlklvdsttsygltgavfaqdkaivqeatrml
    rnaagnfyindkstgsvvgqqpfggarasgtndkpggphyilrwtspqvikethkplgdw
    rysymq