PDB entry 4e2e

View 4e2e on RCSB PDB site
Description: Crystal structure of a tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide (YWHAG) from Homo sapiens at 2.25 A resolution
Class: signaling protein
Keywords: 14-3-3 domain, signal transduction, cell signaling, protein binding, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, SIGNALING PROTEIN, Partnership for T-Cell Biology, TCELL
Deposited on 2012-03-08, released 2012-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: BC020963, YWHAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e2ea_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e2eA (A:)
    gmvdreqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrss
    wrvissieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyes
    kvfylkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalny
    svfyyeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwtsdqqd
    ddggegnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2eA (A:)
    mvdreqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrssw
    rvissieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyesk
    vfylkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnys
    vfyyeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwts