PDB entry 4e1e

View 4e1e on RCSB PDB site
Description: Crystal structure of Trypanosome cruzi farnesyl diphosphate synthase in complex with [2-(n-hexylamino)ethane-1,1-diyl]bisphosphonic acid and Mg2+
Class: transferase/transferase inhibitor
Keywords: geranyl transferase, farnesyl pyrophosphate synthase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-03-06, released 2013-01-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.235
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: FPPS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e1ea_
  • Heterogens: MG, 0MW, IPE, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4e1eA (A:)
    asmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvaeg
    flavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvtt
    qcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkld
    pevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervahl
    igeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdkd
    pakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkrk
    k