PDB entry 4e0b

View 4e0b on RCSB PDB site
Description: 2.17 Angstrom resolution crystal structure of malate dehydrogenase from Vibrio vulnificus CMCP6
Class: oxidoreductase
Keywords: malate dehydrogenase, oxidoreductase, Type III Secretion System, virulence, pathogenesis, toxin, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2012-03-02, released 2012-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Vibrio vulnificus [TaxId:216895]
    Gene: mdh, VV1_0673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DEC2 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d4e0ba1, d4e0ba2, d4e0ba3
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Vibrio vulnificus [TaxId:216895]
    Gene: mdh, VV1_0673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DEC2 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d4e0bb1, d4e0bb2, d4e0bb3
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: Vibrio vulnificus [TaxId:216895]
    Gene: mdh, VV1_0673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DEC2 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d4e0bc1, d4e0bc2, d4e0bc3
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: Vibrio vulnificus [TaxId:216895]
    Gene: mdh, VV1_0673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DEC2 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d4e0bd1, d4e0bd2, d4e0bd3
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e0bA (A:)
    snamkvavigaaggigqalalllknrlpagsdlalydiapvtpgvaadlshipthvsikg
    yagedptpalegadvvlisagvarkpgmdradlfnvnagivkslaeriavvcpnacigii
    tnpvnttvpiaaevlkkagvydkrklfgvttldvirsetfvaelkgqdpgevrvpviggh
    sgvtilpllsqvegvefsdeeiaaltkriqnagtevveakagggsatlsmgqaacrfgla
    lvkalqgeevieyayvegngehasffaqpvklgkegveeilpygelsdfekaaldgmlet
    lnsdiqigvdfvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e0bA (A:)
    namkvavigaaggigqalalllknrlpagsdlalydiapvtpgvaadlshipthvsikgy
    agedptpalegadvvlisagvaradlfnvnagivkslaeriavvcpnacigiitnpvntt
    vpiaaevlkkagvydkrklfgvttldvirsetfvaelkgqdpgevrvpvigghsgvtilp
    llsqvegvefsdeeiaaltkriqnagtevveakagggsatlsmgqaacrfglalvkalqg
    eevieyayvegngehasffaqpvklgkegveeilpygelsdfekaaldgmletlnsdiqi
    gvdfv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e0bB (B:)
    snamkvavigaaggigqalalllknrlpagsdlalydiapvtpgvaadlshipthvsikg
    yagedptpalegadvvlisagvarkpgmdradlfnvnagivkslaeriavvcpnacigii
    tnpvnttvpiaaevlkkagvydkrklfgvttldvirsetfvaelkgqdpgevrvpviggh
    sgvtilpllsqvegvefsdeeiaaltkriqnagtevveakagggsatlsmgqaacrfgla
    lvkalqgeevieyayvegngehasffaqpvklgkegveeilpygelsdfekaaldgmlet
    lnsdiqigvdfvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e0bB (B:)
    amkvavigaaggigqalalllknrlpagsdlalydiapvtpgvaadlshipthvsikgya
    gedptpalegadvvlisagvardradlfnvnagivkslaeriavvcpnacigiitnpvnt
    tvpiaaevlkkagvydkrklfgvttldvirsetfvaelkgqdpgevrvpvigghsgvtil
    pllsqvegvefsdeeiaaltkriqnagtevveakagggsatlsmgqaacrfglalvkalq
    geevieyayvegngehasffaqpvklgkegveeilpygelsdfekaaldgmletlnsdiq
    igvdfv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4e0bC (C:)
    snamkvavigaaggigqalalllknrlpagsdlalydiapvtpgvaadlshipthvsikg
    yagedptpalegadvvlisagvarkpgmdradlfnvnagivkslaeriavvcpnacigii
    tnpvnttvpiaaevlkkagvydkrklfgvttldvirsetfvaelkgqdpgevrvpviggh
    sgvtilpllsqvegvefsdeeiaaltkriqnagtevveakagggsatlsmgqaacrfgla
    lvkalqgeevieyayvegngehasffaqpvklgkegveeilpygelsdfekaaldgmlet
    lnsdiqigvdfvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e0bC (C:)
    amkvavigaaggigqalalllknrlpagsdlalydiapvtpgvaadlshipthvsikgya
    gedptpalegadvvlisagvaadlfnvnagivkslaeriavvcpnacigiitnpvnttvp
    iaaevlkkagvydkrklfgvttldvirsetfvaelkgqdpgevrvpvigghsgvtilpll
    sqvegvefsdeeiaaltkriqnagtevveakagggsatlsmgqaacrfglalvkalqgee
    vieyayvegngehasffaqpvklgkegveeilpygelsdfekaaldgmletlnsdiqigv
    dfv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4e0bD (D:)
    snamkvavigaaggigqalalllknrlpagsdlalydiapvtpgvaadlshipthvsikg
    yagedptpalegadvvlisagvarkpgmdradlfnvnagivkslaeriavvcpnacigii
    tnpvnttvpiaaevlkkagvydkrklfgvttldvirsetfvaelkgqdpgevrvpviggh
    sgvtilpllsqvegvefsdeeiaaltkriqnagtevveakagggsatlsmgqaacrfgla
    lvkalqgeevieyayvegngehasffaqpvklgkegveeilpygelsdfekaaldgmlet
    lnsdiqigvdfvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e0bD (D:)
    amkvavigaaggigqalalllknrlpagsdlalydiapvtpgvaadlshipthvsikgya
    gedptpalegadvvlisagvardradlfnvnagivkslaeriavvcpnacigiitnpvnt
    tvpiaaevlkkagvydkrklfgvttldvirsetfvaelkgqdpgevrvpvigghsgvtil
    pllsqvegvefsdeeiaaltkriqnagtevveakagggsatlsmgqaacrfglalvkalq
    geevieyayvegngehasffaqpvklgkegveeilpygelsdfekaaldgmletlnsdiq
    igvdfv