PDB entry 4dzt

View 4dzt on RCSB PDB site
Description: Aqualysin I: the crystal structure of a serine protease from an extreme thermophile, Thermus aquaticus YT-1
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease, calcium binding, inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-03-01, released 2012-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.135
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Aqualysin-1
  Species: Thermus aquaticus [TaxId:271]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08594 (0-275)
  Domains in SCOPe 2.08: d4dzta_
• Heterogens: PMS, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4dztA (A:)
  atqspapwgldridqrdlplsnsytytatgrgvnvyvidtgirtthrefggrarvgydal
  ggngqdcnghgthvagtiggvtygvakavnlyavrvldcngsgstsgviagvdwvtrnhr
  rpavanmslgggvstaldnavknsiaagvvyavaagndnanacnysparvaealtvgatt
  ssdarasfsnygscvdlfapgasipsawytsdtatqtlngtsmatphvagvaalyleqnp
  satpasvasailngattgrlsgigsgspnrllysll