PDB entry 4dz0

View 4dz0 on RCSB PDB site
Description: Crystal structure of the Cu-adduct of human H-Ferritin variant MIC1 labeled with a dansyl fluorophore
Class: oxidoreductase
Keywords: Four-helix bundle, Oxidoreductase
Deposited on 2012-02-29, released 2013-01-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.229
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794 (0-171)
      • conflict (34)
      • engineered mutation (48)
      • engineered mutation (51)
      • engineered mutation (58)
      • engineered mutation (62)
      • conflict (69)
      • engineered mutation (81)
      • conflict (83)
      • engineered mutation (85)
      • engineered mutation (97)
      • engineered mutation (125)
    Domains in SCOPe 2.04: d4dz0a_
  • Heterogens: AEN, CU, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4dz0A (A:)
tsqvrqnyhqdseaainrqinlelyasyvylsmseyfdrddvalknfacyfhhqsheehe
hahklmklqeqrggriflqdiqkadeddwesglnameaalhleknvnqsllelhklatdk
ndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg