PDB entry 4dyu

View 4dyu on RCSB PDB site
Description: The crystal structure of DNA starvation/stationary phase protection protein Dps from Yersinia pestis KIM 10
Class: oxidoreductase
Keywords: structural genomics, The Center for Structural Genomics of Infectious Diseases, CSGID, OXIDOREDUCTASE
Deposited on 2012-02-29, released 2012-03-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.184
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4dyuk_
  • Chain 'L':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4dyuK (K:)
    snamstaklvktkpsellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrga
    nfvavhemldgfrtaltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqeh
    lkalaeryaivandirkaitevedensadmftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dyuK (K:)
    ellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrganfvavhemldgfrta
    ltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqehlkalaeryaivandi
    rkaitevedensadmftaasrdldkflwfiesnie
    

  • Chain 'L':
    No sequence available.