PDB entry 4dyu

View 4dyu on RCSB PDB site
Description: The crystal structure of DNA starvation/stationary phase protection protein Dps from Yersinia pestis KIM 10
Class: oxidoreductase
Keywords: structural genomics, The Center for Structural Genomics of Infectious Diseases, CSGID, OXIDOREDUCTASE
Deposited on 2012-02-29, released 2012-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.184
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dyua_
  • Chain 'B':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dyub_
  • Chain 'C':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dyuc_
  • Chain 'D':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dyud_
  • Chain 'E':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dyue_
  • Chain 'F':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dyuf_
  • Chain 'G':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dyug_
  • Chain 'H':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dyuh_
  • Chain 'I':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dyui_
  • Chain 'J':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dyuj_
  • Chain 'K':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dyuk_
  • Chain 'L':
    Compound: DNA protection during starvation protein
    Species: Yersinia pestis [TaxId:187410]
    Gene: dps, y1677, Yersinia pestis, YPO2510, YP_2325
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dyul_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dyuA (A:)
    snamstaklvktkpsellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrga
    nfvavhemldgfrtaltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqeh
    lkalaeryaivandirkaitevedensadmftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dyuA (A:)
    ellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrganfvavhemldgfrta
    ltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqehlkalaeryaivandi
    rkaitevedensadmftaasrdldkflwfiesnie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dyuB (B:)
    snamstaklvktkpsellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrga
    nfvavhemldgfrtaltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqeh
    lkalaeryaivandirkaitevedensadmftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dyuB (B:)
    llytrndveehvkvatikrlnqmviqfidlslitkqahwnmrganfvavhemldgfrtal
    tdhldtfaeravqlggvalgtaqvindktplksyptnihsvqehlkalaeryaivandir
    kaitevedensadmftaasrdldkflwfiesnie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dyuC (C:)
    snamstaklvktkpsellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrga
    nfvavhemldgfrtaltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqeh
    lkalaeryaivandirkaitevedensadmftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dyuC (C:)
    llytrndveehvkvatikrlnqmviqfidlslitkqahwnmrganfvavhemldgfrtal
    tdhldtfaeravqlggvalgtaqvindktplksyptnihsvqehlkalaeryaivandir
    kaitevedensadmftaasrdldkflwfiesnie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4dyuD (D:)
    snamstaklvktkpsellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrga
    nfvavhemldgfrtaltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqeh
    lkalaeryaivandirkaitevedensadmftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dyuD (D:)
    sellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrganfvavhemldgfrt
    altdhldtfaeravqlggvalgtaqvindktplksyptnihsvqehlkalaeryaivand
    irkaitevedensadmftaasrdldkflwfiesnie
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4dyuE (E:)
    snamstaklvktkpsellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrga
    nfvavhemldgfrtaltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqeh
    lkalaeryaivandirkaitevedensadmftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dyuE (E:)
    ellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrganfvavhemldgfrta
    ltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqehlkalaeryaivandi
    rkaitevedensadmftaasrdldkflwfiesnie
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4dyuF (F:)
    snamstaklvktkpsellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrga
    nfvavhemldgfrtaltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqeh
    lkalaeryaivandirkaitevedensadmftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dyuF (F:)
    llytrndveehvkvatikrlnqmviqfidlslitkqahwnmrganfvavhemldgfrtal
    tdhldtfaeravqlggvalgtaqvindktplksyptnihsvqehlkalaeryaivandir
    kaitevedensadmftaasrdldkflwfiesnie
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4dyuG (G:)
    snamstaklvktkpsellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrga
    nfvavhemldgfrtaltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqeh
    lkalaeryaivandirkaitevedensadmftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dyuG (G:)
    ellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrganfvavhemldgfrta
    ltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqehlkalaeryaivandi
    rkaitevedensadmftaasrdldkflwfiesnie
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4dyuH (H:)
    snamstaklvktkpsellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrga
    nfvavhemldgfrtaltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqeh
    lkalaeryaivandirkaitevedensadmftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dyuH (H:)
    psellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrganfvavhemldgfr
    taltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqehlkalaeryaivan
    dirkaitevedensadmftaasrdldkflwfiesnie
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4dyuI (I:)
    snamstaklvktkpsellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrga
    nfvavhemldgfrtaltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqeh
    lkalaeryaivandirkaitevedensadmftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dyuI (I:)
    ellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrganfvavhemldgfrta
    ltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqehlkalaeryaivandi
    rkaitevedensadmftaasrdldkflwfiesnie
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4dyuJ (J:)
    snamstaklvktkpsellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrga
    nfvavhemldgfrtaltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqeh
    lkalaeryaivandirkaitevedensadmftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dyuJ (J:)
    ellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrganfvavhemldgfrta
    ltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqehlkalaeryaivandi
    rkaitevedensadmftaasrdldkflwfiesnie
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4dyuK (K:)
    snamstaklvktkpsellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrga
    nfvavhemldgfrtaltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqeh
    lkalaeryaivandirkaitevedensadmftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dyuK (K:)
    ellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrganfvavhemldgfrta
    ltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqehlkalaeryaivandi
    rkaitevedensadmftaasrdldkflwfiesnie
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4dyuL (L:)
    snamstaklvktkpsellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrga
    nfvavhemldgfrtaltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqeh
    lkalaeryaivandirkaitevedensadmftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dyuL (L:)
    ellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrganfvavhemldgfrta
    ltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqehlkalaeryaivandi
    rkaitevedensadmftaasrdldkflwfiesnie