PDB entry 4dxa

View 4dxa on RCSB PDB site
Description: Co-crystal structure of Rap1 in complex with KRIT1
Class: protein binding
Keywords: GTPase, FERM, Protein-protein interaction, GTP binding, Cytoplasmic, PROTEIN BINDING
Deposited on 2012-02-27, released 2012-05-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.198
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rap-1b
    Species: Homo sapiens [TaxId:9606]
    Gene: OK/SW-cl.11, RAP1B, Ras-related protein Rap-1b (RAP1B)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61224 (2-168)
      • expression tag (1)
      • engineered mutation (13)
    Domains in SCOPe 2.05: d4dxaa_
  • Chain 'B':
    Compound: Krev interaction trapped protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CCM1, Krev interaction trapped protein 1 (KRIT1), KRIT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00522 (5-End)
      • expression tag (4)
  • Heterogens: GSP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dxaA (A:)
    gsmreyklvvlgsvgvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildt
    agteqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkc
    dledervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dxaA (A:)
    smreyklvvlgsvgvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildta
    gteqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcd
    ledervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

  • Chain 'B':
    No sequence available.