PDB entry 4dwj

View 4dwj on RCSB PDB site
Description: Crystal structure of Thymidylate Kinase from Staphylococcus aureus in complex with Thymidine Monophosphate
Class: transferase
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, Structures of Mtb Proteins Conferring Susceptibility to Known Mtb Inhibitors, MTBI, THYMIDYLATE KINASE, TRANSFERASE
Deposited on 2012-02-24, released 2012-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158878]
    Gene: tmk, SAV0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dwja_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158878]
    Gene: tmk, SAV0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dwjb_
  • Chain 'C':
    Compound: thymidylate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158878]
    Gene: tmk, SAV0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dwjc_
  • Chain 'D':
    Compound: thymidylate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158878]
    Gene: tmk, SAV0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dwjd_
  • Chain 'E':
    Compound: thymidylate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158878]
    Gene: tmk, SAV0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dwje_
  • Chain 'F':
    Compound: thymidylate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158878]
    Gene: tmk, SAV0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dwjf_
  • Chain 'G':
    Compound: thymidylate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158878]
    Gene: tmk, SAV0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dwjg_
  • Chain 'H':
    Compound: thymidylate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158878]
    Gene: tmk, SAV0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dwjh_
  • Heterogens: TMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dwjA (A:)
    mhhhhhhssgvdlgtenlyfqsnamsafitfegpegsgkttvinevyhrlvkdydvimtr
    epggvptgeeirkivlegndmdirteamlfaasrrehlvlkvipalkegkvvlcdryids
    slayqgyargigveevralnefainglypdltiylnvsaevgreriiknsrdqnrldqed
    lkfhekviegyqeiihnesqrfksvnadqplenvvedtyqtiikyleki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dwjA (A:)
    safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
    eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
    glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihqrfksvnad
    qplenvvedtyqtiikylek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dwjB (B:)
    mhhhhhhssgvdlgtenlyfqsnamsafitfegpegsgkttvinevyhrlvkdydvimtr
    epggvptgeeirkivlegndmdirteamlfaasrrehlvlkvipalkegkvvlcdryids
    slayqgyargigveevralnefainglypdltiylnvsaevgreriiknsrdqnrldqed
    lkfhekviegyqeiihnesqrfksvnadqplenvvedtyqtiikyleki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dwjB (B:)
    safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
    eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
    glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
    nadqplenvvedtyqtiikylek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dwjC (C:)
    mhhhhhhssgvdlgtenlyfqsnamsafitfegpegsgkttvinevyhrlvkdydvimtr
    epggvptgeeirkivlegndmdirteamlfaasrrehlvlkvipalkegkvvlcdryids
    slayqgyargigveevralnefainglypdltiylnvsaevgreriiknsrdqnrldqed
    lkfhekviegyqeiihnesqrfksvnadqplenvvedtyqtiikyleki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dwjC (C:)
    safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
    eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
    glypdltiylnvsaevgreriiknsdqnrldqedlkfhekviegyqeiihnesqrfksvn
    adqplenvvedtyqtiikylek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4dwjD (D:)
    mhhhhhhssgvdlgtenlyfqsnamsafitfegpegsgkttvinevyhrlvkdydvimtr
    epggvptgeeirkivlegndmdirteamlfaasrrehlvlkvipalkegkvvlcdryids
    slayqgyargigveevralnefainglypdltiylnvsaevgreriiknsrdqnrldqed
    lkfhekviegyqeiihnesqrfksvnadqplenvvedtyqtiikyleki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dwjD (D:)
    safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
    eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
    glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihqrfksvnad
    qplenvvedtyqtiikylek
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4dwjE (E:)
    mhhhhhhssgvdlgtenlyfqsnamsafitfegpegsgkttvinevyhrlvkdydvimtr
    epggvptgeeirkivlegndmdirteamlfaasrrehlvlkvipalkegkvvlcdryids
    slayqgyargigveevralnefainglypdltiylnvsaevgreriiknsrdqnrldqed
    lkfhekviegyqeiihnesqrfksvnadqplenvvedtyqtiikyleki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dwjE (E:)
    safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
    eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
    glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihsqrfksvna
    dqplenvvedtyqtiikylek
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4dwjF (F:)
    mhhhhhhssgvdlgtenlyfqsnamsafitfegpegsgkttvinevyhrlvkdydvimtr
    epggvptgeeirkivlegndmdirteamlfaasrrehlvlkvipalkegkvvlcdryids
    slayqgyargigveevralnefainglypdltiylnvsaevgreriiknsrdqnrldqed
    lkfhekviegyqeiihnesqrfksvnadqplenvvedtyqtiikyleki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dwjF (F:)
    safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
    eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
    glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihsqrfksvna
    dqplenvvedtyqtiikylek
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4dwjG (G:)
    mhhhhhhssgvdlgtenlyfqsnamsafitfegpegsgkttvinevyhrlvkdydvimtr
    epggvptgeeirkivlegndmdirteamlfaasrrehlvlkvipalkegkvvlcdryids
    slayqgyargigveevralnefainglypdltiylnvsaevgreriiknsrdqnrldqed
    lkfhekviegyqeiihnesqrfksvnadqplenvvedtyqtiikyleki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dwjG (G:)
    safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
    eamlfaasrrehlvlkvipalkekvvlcdryidsslayqgyargigveevralnefaing
    lypdltiylnvsaevgreriildqedlkfhekviegyqeiihqrfksvnadqplenvved
    tyqtiikyle
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4dwjH (H:)
    mhhhhhhssgvdlgtenlyfqsnamsafitfegpegsgkttvinevyhrlvkdydvimtr
    epggvptgeeirkivlegndmdirteamlfaasrrehlvlkvipalkegkvvlcdryids
    slayqgyargigveevralnefainglypdltiylnvsaevgreriiknsrdqnrldqed
    lkfhekviegyqeiihnesqrfksvnadqplenvvedtyqtiikyleki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dwjH (H:)
    msafitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdir
    teamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefai
    nglypdltiylnvsaevgreriikldqedlkfhekviegyqeiihrfksvnadqplenvv
    edtyqtiikyle