PDB entry 4dvh

View 4dvh on RCSB PDB site
Description: Crystal structure of Trypanosoma cruzi mitochondrial iron superoxide dismutase
Class: oxidoreductase
Keywords: iron Superoxide dismutase, mitochondrial, OXIDOREDUCTASE
Deposited on 2012-02-23, released 2013-03-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.172
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Trypanosoma cruzi [TaxId:353153]
    Gene: Tc00.1047053509775.40
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4DCQ3 (6-207)
      • expression tag (5)
    Domains in SCOPe 2.04: d4dvha1, d4dvha2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Trypanosoma cruzi [TaxId:353153]
    Gene: Tc00.1047053509775.40
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4DCQ3 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.04: d4dvhb1, d4dvhb2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dvhA (A:)
    hhhhhhapaelpklgfnwkdgcapvfsprqmelhytkhhkayvdklnalagttydgksie
    eiilavandaekkglfnqaaqhfnhtfyfrcitpngkampkslesavtaqfgsveqfkda
    fvqagvnnfgsgwtwlcvdpsnknqlvidntsnagcpltkglrpvlavdvwehayykdfe
    nrrpdylkeiwsvidwefvakmhaqaik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dvhA (A:)
    hapaelpklgfnwkdgcapvfsprqmelhytkhhkayvdklnalagttydgksieeiila
    vandaekkglfnqaaqhfnhtfyfrcitpngkampkslesavtaqfgsveqfkdafvqag
    vnnfgsgwtwlcvdpsnknqlvidntsnagcpltkglrpvlavdvwehayykdfenrrpd
    ylkeiwsvidwefvakmhaqaik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dvhB (B:)
    hhhhhhapaelpklgfnwkdgcapvfsprqmelhytkhhkayvdklnalagttydgksie
    eiilavandaekkglfnqaaqhfnhtfyfrcitpngkampkslesavtaqfgsveqfkda
    fvqagvnnfgsgwtwlcvdpsnknqlvidntsnagcpltkglrpvlavdvwehayykdfe
    nrrpdylkeiwsvidwefvakmhaqaik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dvhB (B:)
    hhapaelpklgfnwkdgcapvfsprqmelhytkhhkayvdklnalagttydgksieeiil
    avandaekkglfnqaaqhfnhtfyfrcitpngkampkslesavtaqfgsveqfkdafvqa
    gvnnfgsgwtwlcvdpsnknqlvidntsnagcpltkglrpvlavdvwehayykdfenrrp
    dylkeiwsvidwefvakmhaqai