PDB entry 4dvg

View 4dvg on RCSB PDB site
Description: Crystal structure of E. histolytica Formin1 bound to EhRho1-GTPgammaS
Class: GTP binding/Actin binding Proteins
Keywords: cytoskeleton, Armadillo repeat, GTPase-binding domain, nucleotide-binding, signaling protein, lipoprotein, actin filament formation, prenylation, GTP binding-Actin binding Proteins complex
Deposited on 2012-02-23, released 2012-11-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.219
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho-like small GTPase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhRho1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4dvga_
  • Chain 'B':
    Compound: Diaphanous protein
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhFormin1, EHI_125300
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GSP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dvgA (A:)
    snalafsdmntgagkiengkkalkivvvgdgavgktclllafskgeiptayvptvfenfs
    hvmkykneefilhlwdtagqeeydrlrplsyadsdvvllcfavnnrtsfdnistkwepei
    khyidtaktvlvglkvdlrkdgsddvtkqegddlcqklgcvayieassvakiglnevfek
    svdcifsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dvgA (A:)
    lkivvvgdgavgktclllafskgeiptayvptvfenfshvmkykneefilhlwdtagqee
    ydrlrplsyadsdvvllcfavnnrtsfdnistkwepeikhyidtaktvlvglkvdlrkdg
    sddvtkqegddlcqklgcvayieassvakiglnevfeksvdcif
    

  • Chain 'B':
    No sequence available.