PDB entry 4dvb

View 4dvb on RCSB PDB site
Description: The crystal structure of the Fab fragment of pro-uPA antibody mAb-112
Class: immune system
Keywords: immune system, hydrolase
Deposited on 2012-02-23, released 2013-01-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.224
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab fragment of pro-uPA antibody mAb-112
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DVB (0-212)
  • Chain 'B':
    Compound: Fab fragment of pro-uPA antibody mAb-112
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DVB (0-214)
    Domains in SCOPe 2.06: d4dvbb1, d4dvbb2
  • Chain 'H':
    Compound: Fab fragment of pro-uPA antibody mAb-112
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DVB (0-212)
  • Chain 'L':
    Compound: Fab fragment of pro-uPA antibody mAb-112
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DVB (0-214)
    Domains in SCOPe 2.06: d4dvbl1, d4dvbl2
  • Heterogens: SO4, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dvbB (B:)
    dieltqspaimsaspgekvtmtcrasstvsfhylhwyqqksgaspklwiyatsnlasgvp
    arfsgsgsgtsysltissvetedaatyycqhysayprtfgggtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dvbL (L:)
    dieltqspaimsaspgekvtmtcrasstvsfhylhwyqqksgaspklwiyatsnlasgvp
    arfsgsgsgtsysltissvetedaatyycqhysayprtfgggtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec