PDB entry 4dtg

View 4dtg on RCSB PDB site
Description: Hemostatic effect of a monoclonal antibody mAb 2021 blocking the interaction between FXa and TFPI in a rabbit hemophilia model
Class: blood clotting inhibitor/immune system
Keywords: antibody, inhibitor, blood coagulation, BLOOD CLOTTING INHIBITOR-IMMUNE SYSTEM complex
Deposited on 2012-02-21, released 2012-06-13
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DTG (0-End)
  • Chain 'K':
    Compound: tissue factor pathway inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: LACI, TFPI, TFPI (AMINO ACIDS 119-178), TFPI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10646 (Start-59)
      • expression tag (60)
    Domains in SCOPe 2.02: d4dtgk_
  • Chain 'L':
    Compound: Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DTG (0-218)
  • Heterogens: GOL, MES, PGE, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4dtgK (K:)
    qekpdfcfleedpgicrgyitryfynnqtkqcerfkyggclgnmnnfetleecknicedg
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dtgK (K:)
    ekpdfcfleedpgicrgyitryfynnqtkqcerfkyggclgnmnnfetleecknicedgh
    

  • Chain 'L':
    No sequence available.