PDB entry 4dsn

View 4dsn on RCSB PDB site
Description: Small-molecule ligands bind to a distinct pocket in Ras and inhibit SOS-mediated nucleotide exchange activity
Class: hydrolase
Keywords: Small G-protein, signaling, HYDROLASE
Deposited on 2012-02-19, released 2012-04-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.167
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas, isoform 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (2-End)
      • expression tag (1)
      • engineered mutation (12)
    Domains in SCOPe 2.03: d4dsna_
  • Heterogens: GCP, MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dsnA (A:)
    gsteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkekmskdgkkkkk
    ksktkcvim
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dsnA (A:)
    steyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
    psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkekmskdgkkkkkk