PDB entry 4drv

View 4drv on RCSB PDB site
Description: Cell attachment protein VP8* of a human rotavirus specifically interacts with A-type histo-blood group antigen
Class: viral protein
Keywords: otavirus, viral protein, cell attachment factor, histo blood group antigen, galectin-fold
Deposited on 2012-02-17, released 2012-04-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.152
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Rotavirus sp. [TaxId:10970]
    Gene: VP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86169 (2-162)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d4drva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4drvA (A:)
    gstldgpyqpttfnlpidywmliaptqigrvaegtnttdrwfacvlvepnvqntqreyvl
    dgqtvqlqvsnnsstlwkfilfiklekngaysqystlstsnklcawmkregrvywyagtt
    pnasesyyltinndnsnvscdaefyliprsqtelctqyinngl