PDB entry 4dr0

View 4dr0 on RCSB PDB site
Description: Crystal structure of Bacillus subtilis dimanganese(II) NrdF
Class: oxidoreductase
Keywords: ribonucleotide reductase, manganese, OXIDOREDUCTASE
Deposited on 2012-02-16, released 2012-04-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonucleoside-diphosphate reductase subunit beta
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17390, nrdF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4dr0a_
  • Chain 'B':
    Compound: Ribonucleoside-diphosphate reductase subunit beta
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17390, nrdF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4dr0b_
  • Heterogens: MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dr0A (A:)
    mgsshhhhhhssglvprgshmmtkiydaanwskheddftqmfynqnvkqfwlpeeialng
    dlltwkylgkneqdtymkvlagltlldteqgntgmpivaehvdghqrkavlnfmammena
    vhaksysnifmtlaptetinevfewvkqnkylqkkaqmivglykaiqkddeislfkamva
    svylesflfysgfyyplyfygqgklmqsgeiinlilrdeaihgvyvgllaqeiynkqtee
    kkaelrefaidllnqlyeneleytedlydqvglshdvkkfirynankalmnlgfdpyfee
    edinpivlnglntktkshdffsmkgngykkatveplkdddfyfedekeqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dr0A (A:)
    mtkiydaanwskheddftqmfynqnvkqfwlpeeialngdlltwkylgkneqdtymkvla
    gltlldteqgntgmpivaehvdghqrkavlnfmammenavhaksysnifmtlaptetine
    vfewvkqnkylqkkaqmivglykaiqkddeislfkamvasvylesflfysgfyyplyfyg
    qgklmqsgeiinlilrdeaihgvyvgllaqeiynkqteekkaelrefaidllnqlyenel
    eytedlydqvglshdvkkfirynankalmnlgfdpyfeeedinpivlngl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dr0B (B:)
    mgsshhhhhhssglvprgshmmtkiydaanwskheddftqmfynqnvkqfwlpeeialng
    dlltwkylgkneqdtymkvlagltlldteqgntgmpivaehvdghqrkavlnfmammena
    vhaksysnifmtlaptetinevfewvkqnkylqkkaqmivglykaiqkddeislfkamva
    svylesflfysgfyyplyfygqgklmqsgeiinlilrdeaihgvyvgllaqeiynkqtee
    kkaelrefaidllnqlyeneleytedlydqvglshdvkkfirynankalmnlgfdpyfee
    edinpivlnglntktkshdffsmkgngykkatveplkdddfyfedekeqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dr0B (B:)
    kiydaanwskheddftqmfynqnvkqfwlpeeialngdlltwkylgkneqdtymkvlagl
    tlldteqgntgmpivaehvdghqrkavlnfmammenavhaksysnifmtlaptetinevf
    ewvkqnkylqkkaqmivglykaiqkddeislfkamvasvylesflfysgfyyplyfygqg
    klmqsgeiinlilrdeaihgvyvgllaqeiynkqteekkaelrefaidllnqlyeneley
    tedlydqvglshdvkkfirynankalmnlgfdpyfeeedinpivlnglntk