PDB entry 4dqo

View 4dqo on RCSB PDB site
Description: Crystal Structure of PG16 Fab in Complex with V1V2 Region from HIV-1 strain ZM109
Class: immune system
Keywords: immunoglobulin, immune recognition, immune system, glycan, HIV-1, V1V2, Envelope glycoprotein
Deposited on 2012-02-16, released 2013-03-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.203
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: 1FD6-V1V2 scaffold ZM109 HIV-1 strain
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DQO
  • Chain 'H':
    Compound: PG16 Fab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DQO (0-End)
  • Chain 'L':
    Compound: PG16 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DQO (0-End)
    Domains in SCOPe 2.04: d4dqol1, d4dqol2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4dqoL (L:)
    qsaltqpasvsgspgqtitiscqgtssdvggfdsvswyqqspgkapkvmvfdvshrpsgi
    snrfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dqoL (L:)
    qsaltqpasvsgspgqtitiscqgtssdvggfdsvswyqqspgkapkvmvfdvshrpsgi
    snrfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvapte