PDB entry 4dqn

View 4dqn on RCSB PDB site
Description: Crystal structure of the branched-chain aminotransferase from Streptococcus mutans
Class: transferase
Keywords: aminotransferase, TRANSFERASE
Deposited on 2012-02-16, released 2013-01-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.188
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative branched-chain amino acid aminotransferase IlvE
    Species: Streptococcus mutans [TaxId:1309]
    Gene: ilvE, SMU_1203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4dqna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dqnA (A:)
    gplgstvdldwknlgfeyhklpfryisyykdgkwddgkltedatlhisesspalhygqea
    feglkayrtkdgsvqlfrpnmnaerlqrtadrllmpqvptdkfidaakqvvraneeyvpp
    ygtgatlylrplligvgdvigvhpadeyiftifampvgnyfkgglaptnfliqddydraa
    phgtgaakvggnyaasllpgkvaherqfsdviyldpathtkieevgsanffgitkdnefi
    tplspsilpsvtkysllylaehrfgmkaiegdvcvdeldkfveagacgtaavispiggvq
    hgddfhvfysetevgpvthklydeltgiqfgdvkapegwiykvdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dqnA (A:)
    tvdldwknlgfeyhklpfryisyykdgkwddgkltedatlhisesspalhygqeafeglk
    ayrtkdgsvqlfrpnmnaerlqrtadrllmpqvptdkfidaakqvvraneeyvppygtga
    tlylrplligvgdvigvhpadeyiftifampvgnyfkgglaptnfliqddydraaphgtg
    aakvggnyaasllpgkvaherqfsdviyldpathtkieevgsanffgitkdnefitplsp
    silpsvtkysllylaehrfgmkaiegdvcvdeldkfveagacgtaavispiggvqhgddf
    hvfysetevgpvthklydeltgiqfgdvkapegwiykvdd