PDB entry 4dq0

View 4dq0 on RCSB PDB site
Description: The crystal structure of tellurite resistance protein from Escherichia coli O157:H7 str. Sakai
Class: transferase
Keywords: structural genomics, PSI-Biology, Protein Structure Initiative, MCSG, Midwest Center for Structural Genomics, TRANSFERASE
Deposited on 2012-02-14, released 2012-02-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.182
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tellurite resistance protein
    Species: Escherichia coli [TaxId:386585]
    Gene: ECs2035, Escherichia coli, tehB, Z2288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dq0a_
  • Chain 'B':
    Compound: Tellurite resistance protein
    Species: Escherichia coli [TaxId:386585]
    Gene: ECs2035, Escherichia coli, tehB, Z2288
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8X9V6 (3-199)
      • expression tag (2)
    Domains in SCOPe 2.07: d4dq0b1, d4dq0b2
  • Chain 'C':
    Compound: Tellurite resistance protein
    Species: Escherichia coli [TaxId:386585]
    Gene: ECs2035, Escherichia coli, tehB, Z2288
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8X9V6 (3-199)
      • expression tag (2)
    Domains in SCOPe 2.07: d4dq0c1, d4dq0c2
  • Chain 'D':
    Compound: Tellurite resistance protein
    Species: Escherichia coli [TaxId:386585]
    Gene: ECs2035, Escherichia coli, tehB, Z2288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dq0d_
  • Heterogens: NHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dq0A (A:)
    snamiirdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvda
    wdknamsianveriksienldnlhtrvvdlnnltfdgeydfilstvvlmfleaktipgli
    anmqrctkpggynlivaamdtadypctvgfpfafkegelrryyegwemvkynedvgelhr
    tdangnriklrfatmlarkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dq0A (A:)
    irdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdawdkna
    msianveriksienldnlhtrvvdlnnltfdgeydfilstvvlmfleaktipglianmqr
    ctkpggynlivaamdtadypctvgfpfafkegelrryyegwemvkynedvgelhrtdang
    nriklrfatmlarkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dq0B (B:)
    snamiirdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvda
    wdknamsianveriksienldnlhtrvvdlnnltfdgeydfilstvvlmfleaktipgli
    anmqrctkpggynlivaamdtadypctvgfpfafkegelrryyegwemvkynedvgelhr
    tdangnriklrfatmlarkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dq0B (B:)
    amiirdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdawd
    knamsianveriksienldnlhtrvvdlnnltfdgeydfilstvvlmfleaktipglian
    mqrctkpggynlivaamdtadypctvgfpfafkegelrryyegwemvkynedvgelhrtd
    angnriklrfatmlarkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dq0C (C:)
    snamiirdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvda
    wdknamsianveriksienldnlhtrvvdlnnltfdgeydfilstvvlmfleaktipgli
    anmqrctkpggynlivaamdtadypctvgfpfafkegelrryyegwemvkynedvgelhr
    tdangnriklrfatmlarkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dq0C (C:)
    amiirdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdawd
    knamsianveriksienldnlhtrvvdlnnltfdgeydfilstvvlmfleaktipglian
    mqrctkpggynlivaamdtadypctvgfpfafkegelrryyegwemvkynedvgelhrtd
    angnriklrfatmlarkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4dq0D (D:)
    snamiirdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvda
    wdknamsianveriksienldnlhtrvvdlnnltfdgeydfilstvvlmfleaktipgli
    anmqrctkpggynlivaamdtadypctvgfpfafkegelrryyegwemvkynedvgelhr
    tdangnriklrfatmlarkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dq0D (D:)
    iirdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdawdkn
    amsianveriksienldnlhtrvvdlnnltfdgeydfilstvvlmfleaktipglianmq
    rctkpggynlivaamdtadypctvgfpfafkegelrryyegwemvkynedvgelhrtgnr
    iklrfatmlarkk