PDB entry 4dou

View 4dou on RCSB PDB site
Description: Crystal Structure of a Single-chain Trimer of Human Adiponectin Globular Domain
Class: hormone
Keywords: Single-chain globular domain, Calcium binding, C1Q-like domain, growth factor, serum, HORMONE
Deposited on 2012-02-10, released 2012-02-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adiponectin
    Species: Homo sapiens [TaxId:9606]
    Gene: ACDC, ACRP30, adiponectin, ADIPOQ, APM1, GBP28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4doua1, d4doua2, d4doua3
  • Heterogens: CA, NA, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4douA (A:)
    hhhhhhhhenlyfqgaspgegayvyrsafsvgletyvtipnmpirftkifynqqnhydgs
    tgkfhcnipglyyfayhitvymkdvkvslfkkdkamlftydqyqennvdqasgsvllhle
    vgdqvwlqvygegernglyadndndstftgfllyhdtnpgegayvyrsafsvgletyvti
    pnmpirftkifynqqnhydgstgkfhcnipglyyfayhitvymkdvkvslfkkdkamlft
    ydqyqennvdqasgsvllhlevgdqvwlqvygegernglyadndndstftgfllyhdtnp
    gegayvyrsafsvgletyvtipnmpirftkifynqqnhydgstgkfhcnipglyyfayhi
    tvymkdvkvslfkkdkamlftydqyqennvdqasgsvllhlevgdqvwlqvygegerngl
    yadndndstftgfllyhdtngs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4douA (A:)
    ayvyrsafsvgletyvtmpirftkifynqqnhydgstgkfhcnipglyyfayhitvymkd
    vkvslfkkdkamlftydqyqennvdqasgsvllhlevgdqvwlqvyernglyadndndst
    ftgfllyhdtnpgegayvyrsafsvglempirftkifynqqnhydgstgkfhcnipglyy
    fayhitvymkdvkvslfkkdkamlftydqyqennvdqasgsvllhlevgdqvwlqvygeg
    ernglyadndndstftgfllyhdtnpyvyrsafsvgletyipnmpirftkifynqqnhyd
    gstgkfhcnipglyyfayhitvymkdvkvslfkkdkamlftydqyqennvdqasgsvllh
    levgdqvwlqvygegernglyadndndstftgfllyhdt