PDB entry 4dnq

View 4dnq on RCSB PDB site
Description: Crystal Structure of DAD2 S96A mutant
Class: hydrolase
Keywords: alpha/beta hydrolase, HYDROLASE
Deposited on 2012-02-08, released 2012-11-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.244
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dad2
    Species: Petunia hybrida [TaxId:4102]
    Gene: dad2
    Database cross-references and differences (RAF-indexed):
    • PDB 4DNQ
    Domains in SCOPe 2.06: d4dnqa_
  • Chain 'B':
    Compound: dad2
    Species: Petunia hybrida [TaxId:4102]
    Gene: dad2
    Database cross-references and differences (RAF-indexed):
    • PDB 4DNQ
    Domains in SCOPe 2.06: d4dnqb_
  • Chain 'C':
    Compound: dad2
    Species: Petunia hybrida [TaxId:4102]
    Gene: dad2
    Database cross-references and differences (RAF-indexed):
    • PDB 4DNQ
    Domains in SCOPe 2.06: d4dnqc_
  • Chain 'D':
    Compound: dad2
    Species: Petunia hybrida [TaxId:4102]
    Gene: dad2
    Database cross-references and differences (RAF-indexed):
    • PDB 4DNQ
    Domains in SCOPe 2.06: d4dnqd_
  • Chain 'E':
    Compound: dad2
    Species: Petunia hybrida [TaxId:4102]
    Gene: dad2
    Database cross-references and differences (RAF-indexed):
    • PDB 4DNQ
    Domains in SCOPe 2.06: d4dnqe_
  • Chain 'F':
    Compound: dad2
    Species: Petunia hybrida [TaxId:4102]
    Gene: dad2
    Database cross-references and differences (RAF-indexed):
    • PDB 4DNQ
    Domains in SCOPe 2.06: d4dnqf_
  • Chain 'G':
    Compound: dad2
    Species: Petunia hybrida [TaxId:4102]
    Gene: dad2
    Database cross-references and differences (RAF-indexed):
    • PDB 4DNQ
    Domains in SCOPe 2.06: d4dnqg_
  • Chain 'H':
    Compound: dad2
    Species: Petunia hybrida [TaxId:4102]
    Gene: dad2
    Database cross-references and differences (RAF-indexed):
    • PDB 4DNQ
    Domains in SCOPe 2.06: d4dnqh_
  • Chain 'I':
    Compound: dad2
    Species: Petunia hybrida [TaxId:4102]
    Gene: dad2
    Database cross-references and differences (RAF-indexed):
    • PDB 4DNQ
    Domains in SCOPe 2.06: d4dnqi_
  • Chain 'J':
    Compound: dad2
    Species: Petunia hybrida [TaxId:4102]
    Gene: dad2
    Database cross-references and differences (RAF-indexed):
    • PDB 4DNQ
    Domains in SCOPe 2.06: d4dnqj_
  • Chain 'K':
    Compound: dad2
    Species: Petunia hybrida [TaxId:4102]
    Gene: dad2
    Database cross-references and differences (RAF-indexed):
    • PDB 4DNQ
    Domains in SCOPe 2.06: d4dnqk_
  • Chain 'L':
    Compound: dad2
    Species: Petunia hybrida [TaxId:4102]
    Gene: dad2
    Database cross-references and differences (RAF-indexed):
    • PDB 4DNQ
    Domains in SCOPe 2.06: d4dnql_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dnqA (A:)
    ggmgqtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsv
    npdffdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfsklil
    igasprflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtl
    fnmrpditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntv
    hwlnieghlphlsaptllaqelrralshr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnqA (A:)
    tlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsvnpdff
    dfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfskliligasp
    rflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtlfnmrp
    ditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntvhwlni
    eghlphlsaptllaqelrrals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dnqB (B:)
    ggmgqtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsv
    npdffdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfsklil
    igasprflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtl
    fnmrpditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntv
    hwlnieghlphlsaptllaqelrralshr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnqB (B:)
    tlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsvnpdff
    dfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfskliligasp
    rflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtlfnmrp
    ditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntvhwlni
    eghlphlsaptllaqelrrals
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dnqC (C:)
    ggmgqtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsv
    npdffdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfsklil
    igasprflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtl
    fnmrpditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntv
    hwlnieghlphlsaptllaqelrralshr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnqC (C:)
    qtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsvnpdf
    fdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfskliligas
    prflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtlfnmr
    pditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntvhwln
    ieghlphlsaptllaqelrrals
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4dnqD (D:)
    ggmgqtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsv
    npdffdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfsklil
    igasprflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtl
    fnmrpditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntv
    hwlnieghlphlsaptllaqelrralshr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnqD (D:)
    qtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsvnpdf
    fdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfskliligas
    prflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtlfnmr
    pditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntvhwln
    ieghlphlsaptllaqelrrals
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4dnqE (E:)
    ggmgqtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsv
    npdffdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfsklil
    igasprflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtl
    fnmrpditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntv
    hwlnieghlphlsaptllaqelrralshr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnqE (E:)
    tlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsvnpdff
    dfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfskliligasp
    rflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtlfnmrp
    ditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntvhwlni
    eghlphlsaptllaqelrrals
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4dnqF (F:)
    ggmgqtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsv
    npdffdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfsklil
    igasprflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtl
    fnmrpditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntv
    hwlnieghlphlsaptllaqelrralshr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnqF (F:)
    qtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsvnpdf
    fdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfskliligas
    prflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtlfnmr
    pditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntvhwln
    ieghlphlsaptllaqelrrals
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4dnqG (G:)
    ggmgqtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsv
    npdffdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfsklil
    igasprflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtl
    fnmrpditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntv
    hwlnieghlphlsaptllaqelrralshr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnqG (G:)
    qtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsvnpdf
    fdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfskliligas
    prflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtlfnmr
    pditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntvhwln
    ieghlphlsaptllaqelrrals
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4dnqH (H:)
    ggmgqtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsv
    npdffdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfsklil
    igasprflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtl
    fnmrpditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntv
    hwlnieghlphlsaptllaqelrralshr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnqH (H:)
    tlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsvnpdff
    dfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfskliligasp
    rflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtlfnmrp
    ditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntvhwlni
    eghlphlsaptllaqelrrals
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4dnqI (I:)
    ggmgqtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsv
    npdffdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfsklil
    igasprflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtl
    fnmrpditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntv
    hwlnieghlphlsaptllaqelrralshr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnqI (I:)
    gqtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsvnpd
    ffdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfskliliga
    sprflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtlfnm
    rpditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntvhwl
    nieghlphlsaptllaqelrrals
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4dnqJ (J:)
    ggmgqtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsv
    npdffdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfsklil
    igasprflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtl
    fnmrpditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntv
    hwlnieghlphlsaptllaqelrralshr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnqJ (J:)
    qtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsvnpdf
    fdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfskliligas
    prflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtlfnmr
    pditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntvhwln
    ieghlphlsaptllaqelrrals
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4dnqK (K:)
    ggmgqtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsv
    npdffdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfsklil
    igasprflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtl
    fnmrpditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntv
    hwlnieghlphlsaptllaqelrralshr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnqK (K:)
    tlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsvnpdff
    dfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfskliligasp
    rflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtlfnmrp
    ditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntvhwlni
    eghlphlsaptllaqelrrals
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4dnqL (L:)
    ggmgqtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsv
    npdffdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfsklil
    igasprflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtl
    fnmrpditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntv
    hwlnieghlphlsaptllaqelrralshr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnqL (L:)
    gqtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsvnpd
    ffdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfskliliga
    sprflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtlfnm
    rpditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntvhwl
    nieghlphlsaptllaqelrrals