PDB entry 4dnk

View 4dnk on RCSB PDB site
Description: Crystal structure of a tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide (YWHAB) from homo sapiens at 2.20 A resolution.
Class: signaling protein
Keywords: 14-3-3 domain, phosphorylation, protein-protein binding, cell signaling, cell regulation, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, SIGNALING PROTEIN, Partnership for T-Cell Biology, TCELL
Deposited on 2012-02-08, released 2012-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein beta/alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: BC001359, YWHAB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dnka_
  • Chain 'B':
    Compound: 14-3-3 protein beta/alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: BC001359, YWHAB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dnkb_
  • Heterogens: PO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dnkA (A:)
    gmtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrs
    swrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvf
    ylkmkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvf
    yyeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsenqgdeg
    dagegen
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnkA (A:)
    tmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrssw
    rvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfyl
    kmkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfyy
    eilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dnkB (B:)
    gmtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrs
    swrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvf
    ylkmkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvf
    yyeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsenqgdeg
    dagegen
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnkB (B:)
    mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
    wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfy
    lkmkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsen