PDB entry 4dnj

View 4dnj on RCSB PDB site
Description: The crystal structures of 4-methoxybenzoate bound CYP199A2
Class: oxidoreductase
Keywords: Oxidoreductase
Deposited on 2012-02-08, released 2012-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.16
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytochrome P450
    Species: Rhodopseudomonas palustris [TaxId:258594]
    Gene: RPA1871
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dnja_
  • Heterogens: HEM, ANN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dnjA (A:)
    mttapslvpvttpsqhgagvphlgidpfaldyfadpypeqetlreagpvvyldkwnvygv
    aryaevyavlndpltfcssrgvglsdfkkekpwrppslileadppahtrtravlskvlsp
    atmkrlrdgfaaaadakidellarggnidaiadlaeayplsvfpdamglkqegrenllpy
    aglvfnafgppnelrqsaiersaphqayvaeqcqrpnlapggfgacihafsdtgeitpee
    apllvrsllsagldttvngiaaavyclarfpdefarlradpslarnafeeavrfespvqt
    ffrtttrdvelagatigegekvlmflgsanrdprrwddpdryditrktsghvgfgsgvhm
    cvgqlvarlegevvlaalarkvaaieiagplkrrfnntlrgleslpiqltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnjA (A:)
    sqhgagvphlgidpfaldyfadpypeqetlreagpvvyldkwnvygvaryaevyavlndp
    ltfcssrgvglsdfkkekpwrppslileadppahtrtravlskvlspatmkrlrdgfaaa
    adakidellarggnidaiadlaeayplsvfpdamglkqegrenllpyaglvfnafgppne
    lrqsaiersaphqayvaeqcqrpnlapggfgacihafsdtgeitpeeapllvrsllsagl
    dttvngiaaavyclarfpdefarlradpslarnafeeavrfespvqtffrtttrdvelag
    atigegekvlmflgsanrdprrwddpdryditrktsghvgfgsgvhmcvgqlvarlegev
    vlaalarkvaaieiagplkrrfnntlrgleslpiqltpa