PDB entry 4dng

View 4dng on RCSB PDB site
Description: Crystal structure of putative aldehyde dehydrogenase from Bacillus subtilis subsp. subtilis str. 168
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, NYSGRC, PSI-Biology, New York Structural Genomics Research Consortium, OXIDOREDUCTASE
Deposited on 2012-02-08, released 2012-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.185
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized aldehyde dehydrogenase AldY
    Species: Bacillus subtilis [TaxId:1423]
    Gene: aldY, BSU38830, CAB15909.1, yxkE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dnga_
  • Chain 'B':
    Compound: Uncharacterized aldehyde dehydrogenase AldY
    Species: Bacillus subtilis [TaxId:1423]
    Gene: aldY, BSU38830, CAB15909.1, yxkE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dngb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dngA (A:)
    msfetlnksfingkwtggesgrtedilnpydqsvittaslatgkqledafdiaqkaqkew
    aksttedrkavlqkargylhenrddiimmiaretggtiikstieleqtiaildeamtytg
    elggvkevpsdiegktnkiyrlplgvissispfnfpmnlsmrsiapaialgnsvvhkpdi
    qtaisggtiiakafehaglpagvlnvmltdvkeigdgmltnpiprlisftgstavgrhig
    eiagrafkrmalelggnnpfavlsdadvdravdaaifgkfihqgqicmiinriivhqdvy
    defvekftarvkqlpygdqtdpktvvgplinerqiekaleiieqaktdgielavegkrvg
    nvltpyvfvgadnnskiaqtelfapiatiikagsdqeaidmandteyglssavftsdlek
    gekfalqidsgmthvndqsvndspniafggnkasgvgrfgnpwvveeftvtkwisiqkqy
    rkypf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dngA (A:)
    msfetlnksfingkwtggesgrtedilnpydqsvittaslatgkqledafdiaqkaqkew
    aksttedrkavlqkargylhenrddiimmiaretggtiikstieleqtiaildeamtytg
    elggvkevpsdiegktnkiyrlplgvissispfnfpmnlsmrsiapaialgnsvvhkpdi
    qtaisggtiiakafehaglpagvlnvmltdvkeigdgmltnpiprlisftgstavgrhig
    eiagrafkrmalelggnnpfavlsdadvdravdaaifgkfihqmiinriivhqdvydefv
    ekftarvkqlpygdqtdpktvvgplinerqiekaleiieqaktdgielavegkrvgnvlt
    pyvfvgadnnskiaqtelfapiatiikagsdqeaidmandteyglssavftsdlekgekf
    alqidsgmthvndqnpwvveeftvtkwisiqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dngB (B:)
    msfetlnksfingkwtggesgrtedilnpydqsvittaslatgkqledafdiaqkaqkew
    aksttedrkavlqkargylhenrddiimmiaretggtiikstieleqtiaildeamtytg
    elggvkevpsdiegktnkiyrlplgvissispfnfpmnlsmrsiapaialgnsvvhkpdi
    qtaisggtiiakafehaglpagvlnvmltdvkeigdgmltnpiprlisftgstavgrhig
    eiagrafkrmalelggnnpfavlsdadvdravdaaifgkfihqgqicmiinriivhqdvy
    defvekftarvkqlpygdqtdpktvvgplinerqiekaleiieqaktdgielavegkrvg
    nvltpyvfvgadnnskiaqtelfapiatiikagsdqeaidmandteyglssavftsdlek
    gekfalqidsgmthvndqsvndspniafggnkasgvgrfgnpwvveeftvtkwisiqkqy
    rkypf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dngB (B:)
    msfetlnksfingkwtggesgrtedilnpydqsvittaslatgkqledafdiaqkaqkew
    aksttedrkavlqkargylhenrddiimmiaretggtiikstieleqtiaildeamtytg
    elggvkeegktnkiyrlplgvissispfnfpmnlsmrsiapaialgnsvvhkpdiqtais
    ggtiiakafehaglpagvlnvmltdvkeigdgmltnpiprlisftgstavgrhigeiagr
    afkrmalelggnnpfavlsdadvdravdaaifgkfihqcmiinriivhqdvydefvekft
    arvkqlpygdqtdpktvvgplinerqiekaleiieqaktdgielavegkrvgnvltpyvf
    vgadnnskiaqtelfapiatiikagsdqeaidmandteyglssavftsdlekgekfalqi
    dsgmthvndnpwvveeftvtkwisiqk