PDB entry 4dn3

View 4dn3 on RCSB PDB site
Description: Crystal structure of anti-mcp-1 antibody cnto888
Class: immune system
Keywords: antibody, IMMUNE SYSTEM
Deposited on 2012-02-08, released 2012-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.194
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: cnto888 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DN3
  • Chain 'L':
    Compound: cnto888 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DN3 (0-End)
    Domains in SCOPe 2.07: d4dn3l1, d4dn3l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4dn3L (L:)
    eivltqspatlslspgeratlscrasqsvsdaylawyqqkpgqaprlliydassratgvp
    arfsgsgsgtdftltisslepedfavyychqyiqlhsftfgqgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dn3L (L:)
    eivltqspatlslspgeratlscrasqsvsdaylawyqqkpgqaprlliydassratgvp
    arfsgsgsgtdftltisslepedfavyychqyiqlhsftfgqgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrg