PDB entry 4dmf

View 4dmf on RCSB PDB site
Description: Crystal structure of the CFTR inhibitory factor Cif with the H177A mutation
Class: hydrolase
Keywords: Alpha Beta Hydrolase, Epoxide Hydrolase, secreted, HYDROLASE
Deposited on 2012-02-07, released 2013-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-26, with a file datestamp of 2015-08-21.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative hydrolase
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02P97 (0-End)
      • engineered mutation (152)
    Domains in SCOPe 2.06: d4dmfa_
  • Chain 'B':
    Compound: Putative hydrolase
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02P97 (0-End)
      • engineered mutation (152)
    Domains in SCOPe 2.06: d4dmfb_
  • Chain 'C':
    Compound: Putative hydrolase
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02P97 (0-End)
      • engineered mutation (152)
    Domains in SCOPe 2.06: d4dmfc_
  • Chain 'D':
    Compound: Putative hydrolase
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02P97 (0-End)
      • engineered mutation (152)
    Domains in SCOPe 2.06: d4dmfd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dmfA (A:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwafsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dmfA (A:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwafsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dmfB (B:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwafsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dmfB (B:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwafsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dmfC (C:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwafsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dmfC (C:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwafsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4dmfD (D:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwafsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dmfD (D:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwafsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsr