PDB entry 4dlj

View 4dlj on RCSB PDB site
Description: Human p38 MAP kinase in complex with RL163
Class: Transferase/Transferase Inhibitor
Keywords: MAP Kinase Insert, Transferase, Lipid Binding Pocket, Transferase-Transferase Inhibitor complex
Deposited on 2012-02-06, released 2013-01-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4dlja_
  • Heterogens: 6RG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dljA (A:)
    gsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dljA (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildvatrwyrapeimlnwm
    hynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarny
    iqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddep
    vadpydqsfesrdllidewksltydevisfvpppld