PDB entry 4dkf

View 4dkf on RCSB PDB site
Description: Crystal Structure of Human Interleukin-34 Bound to FAb2
Class: cytokine/immune system
Keywords: dimeric four-helix bundle cytokine, IgG, glycosylation, CYTOKINE-IMMUNE SYSTEM complex
Deposited on 2012-02-03, released 2012-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.227
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-34
    Species: Homo sapiens [TaxId:9606]
    Gene: IL34, C16orf77
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Interleukin-34
    Species: Homo sapiens [TaxId:9606]
    Gene: IL34, C16orf77
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: FAb2 Heavy Chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DKF
  • Chain 'I':
    Compound: FAb2 Heavy Chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DKF
  • Chain 'L':
    Compound: FAb2 Light Chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DKF (0-End)
    Domains in SCOPe 2.07: d4dkfl1, d4dkfl2
  • Chain 'M':
    Compound: FAb2 Light Chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DKF (0-End)
    Domains in SCOPe 2.07: d4dkfm1, d4dkfm2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4dkfL (L:)
    diqmtqspsslsasvgdrvtitcrasqsissylawyqqkpgkapklliygassrasgvps
    rfsgsgsgtdftltisslqpedfatyycqqywsepvtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dkfL (L:)
    diqmtqspsslsasvgdrvtitcrasqsissylawyqqkpgkapklliygassrasgvps
    rfsgsgsgtdftltisslqpedfatyycqqywsepvtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4dkfM (M:)
    diqmtqspsslsasvgdrvtitcrasqsissylawyqqkpgkapklliygassrasgvps
    rfsgsgsgtdftltisslqpedfatyycqqywsepvtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dkfM (M:)
    diqmtqspsslsasvgdrvtitcrasqsissylawyqqkpgkapklliygassrasgvps
    rfsgsgsgtdftltisslqpedfatyycqqywsepvtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    skadyekhkvyacevthqglsspvtks