PDB entry 4dj0

View 4dj0 on RCSB PDB site
Description: Thaumatin I by Langmuir-Blodgett Hanging Drop Method at 1.98A resolution for Unique Water Distribution
Class: plant protein
Keywords: Water Distribution, Thin Film, Langmuir Blodgett, PLANT PROTEIN
Deposited on 2012-02-01, released 2012-07-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.17
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thaumatin I
  Species: Thaumatococcus daniellii [TaxId:4621]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8RVT0 (0-206)
    • conflict (45)
  Domains in SCOPe 2.08: d4dj0a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4dj0A (A:)
  atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtkggkiwartdcyfdd
  sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
  crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
  fsyvldkpttvtcpgssnyrvtfcpta