PDB entry 4die

View 4die on RCSB PDB site
Description: Crystal structure of a cytidylate kinase CmK from Mycobacterium abscessus bound to cytidine-5'-monophosphate
Class: transferase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, kinase, Mycobacterium, Cytidine monophosphate kinase, CK, TRANSFERASE
Deposited on 2012-01-30, released 2012-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidylate kinase
    Species: Mycobacterium abscessus [TaxId:561007]
    Gene: cmk, MAB_2371
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1MB31 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.07: d4diea1, d4diea2
  • Chain 'B':
    Compound: Cytidylate kinase
    Species: Mycobacterium abscessus [TaxId:561007]
    Gene: cmk, MAB_2371
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1MB31 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.07: d4dieb1, d4dieb2
  • Chain 'C':
    Compound: Cytidylate kinase
    Species: Mycobacterium abscessus [TaxId:561007]
    Gene: cmk, MAB_2371
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1MB31 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.07: d4diec1, d4diec2
  • Chain 'D':
    Compound: Cytidylate kinase
    Species: Mycobacterium abscessus [TaxId:561007]
    Gene: cmk, MAB_2371
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1MB31 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.07: d4died1, d4died2
  • Heterogens: C5P, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dieA (A:)
    gpgsmvvavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaia
    aatdqvpmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrela
    essgavvvegrdigtvvlpdadvkiyltasaqaraqrrnaqnvsgggddeyekvladvqr
    rdhldstravsplrpaedalevdtsdmtqeqvvahlldlvrtragasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dieA (A:)
    smvvavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaiaaat
    dqvpmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrelaess
    gavvvegrdigtvvlpdadvkiyltasaqaraqrrnaqnvladvqrrdhldstrlrpaed
    alevdtsdmtqeqvvahlldlvrt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dieB (B:)
    gpgsmvvavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaia
    aatdqvpmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrela
    essgavvvegrdigtvvlpdadvkiyltasaqaraqrrnaqnvsgggddeyekvladvqr
    rdhldstravsplrpaedalevdtsdmtqeqvvahlldlvrtragasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dieB (B:)
    smvvavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaiaaat
    dqvpmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrelaess
    gavvvegrdigtvvlpdadvkiyltasaqaraqrrnqrrdhldstravsplrpaedalev
    dtsdmtqeqvvahlldlvrtr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dieC (C:)
    gpgsmvvavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaia
    aatdqvpmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrela
    essgavvvegrdigtvvlpdadvkiyltasaqaraqrrnaqnvsgggddeyekvladvqr
    rdhldstravsplrpaedalevdtsdmtqeqvvahlldlvrtragasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dieC (C:)
    smvvavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaiaaat
    dqvpmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrelaess
    gavvvegrdigtvvlpdadvkiyltasaqaraqrrnaqnvsekvladvqrrdhldstrav
    splrpaedalevdtsdmtqeqvvahlldlvrtr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4dieD (D:)
    gpgsmvvavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaia
    aatdqvpmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrela
    essgavvvegrdigtvvlpdadvkiyltasaqaraqrrnaqnvsgggddeyekvladvqr
    rdhldstravsplrpaedalevdtsdmtqeqvvahlldlvrtragasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dieD (D:)
    smvvavdgpsgtgkssvakelarqlgasyldtgamyrivtlwvlragvdltdpaaiaaat
    dqvpmsvssdpdaqtallagedvsvpirgnevtgavsavsavpavrerlvrqqrelaess
    gavvvegrdigtvvlpdadvkiyltasaqaraqrvqrrdhldstravsplrpaedalevd
    tsdmtqeqvvahlldlvrtr