PDB entry 4dhe

View 4dhe on RCSB PDB site
Description: Crystal structure of a probable GTP-binding protein engB from Burkholderia thailandensis
Class: cell cycle
Keywords: melioidosis, RAS-like GTPase, cell division, cell cycle, septation, GTP-binding
Deposited on 2012-01-27, released 2012-02-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.237
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable GTP-binding protein engB
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I3037, engB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2SU58 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4dhea1, d4dhea2
  • Chain 'B':
    Compound: Probable GTP-binding protein engB
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I3037, engB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2SU58 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4dheb1, d4dheb2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dheA (A:)
    gpgsmafllhqarffttvnhlrdlpptvqpeiafagrsnagkstainvlcnqkrlafask
    tpgrtqhinyfsvgpaaepvahlvdlpgygyaevpgaakahweqllssylqtrpqlcgmi
    lmmdarrplteldrrmiewfaptgkpihslltkcdkltrqesinalratqksldayrdag
    yagkltvqlfsalkrtglddahalieswlrpaaadedhaavae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dheA (A:)
    gsmafllhqarffttvnhlrdlpptvqpeiafagrsnagkstainvlcnqkrlafasktp
    grtqhinyfsvgpaaepvahlvdlpgygyaevpgaakahweqllssylqtrpqlcgmilm
    mdarrplteldrrmiewfaptgkpihslltkcdkltrqesinalratqksldayrdagya
    gkltvqlfsalkrtglddahalieswlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dheB (B:)
    gpgsmafllhqarffttvnhlrdlpptvqpeiafagrsnagkstainvlcnqkrlafask
    tpgrtqhinyfsvgpaaepvahlvdlpgygyaevpgaakahweqllssylqtrpqlcgmi
    lmmdarrplteldrrmiewfaptgkpihslltkcdkltrqesinalratqksldayrdag
    yagkltvqlfsalkrtglddahalieswlrpaaadedhaavae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dheB (B:)
    gsmafllhqarffttvnhlrdlpptvqpeiafagrsnagkstainvlcnqkrlafahiny
    fsvgpaaepvahlvdlpgykahweqllssylqtrpqlcgmilmmdarrplteldrrmiew
    faptgkpihslltkcdkltrqesinalratqksldayrdagyagkltvqlfsalkrtgld
    dahalieswlr