PDB entry 4dgi

View 4dgi on RCSB PDB site
Description: Structure of POM1 FAB fragment complexed with human PrPc Fragment 120-230
Class: protein binding
Keywords: prion, antibody, PROTEIN BINDING
Deposited on 2012-01-26, released 2012-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.259
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PRNP, PRIP, PRP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4dgia_
  • Chain 'H':
    Compound: POM1 Fab Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DGI (0-217)
  • Chain 'L':
    Compound: POM1 Fab Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DGI (0-212)
    Domains in SCOPe 2.06: d4dgil1, d4dgil2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dgiA (A:)
    avvgglggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdc
    vnitikqhtvttttkgenftetdvkmmervveqmcitqyeresqayyqrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dgiA (A:)
    ggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvnitik
    qhtvttttkgenftetdvkmmervveqmcitqyeres
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dgiL (L:)
    divltqspailsvspgervsfscrasqnigtsihwyqqrtnesprliikyasesisgips
    rfsgsgsgtdftlsinsvesediadyycqqsntwpytfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsetdqdskdstysmsstlt
    ltkdeyerhntytceathktstspivksfnrne