PDB entry 4dfg
View 4dfg on RCSB PDB site
Description: Crystal Structure of Wild-type HIV-1 Protease with Cyclopentyltetrahydro- furanyl Urethanes as P2-ligand, GRL-0249A
Class: hydrolase/hydrolase inhibitor
Keywords: aspartic acid protease, HIV-1 protease inhibitor GRL-0249A, Cyclopentyltetrahydro- furanyl Urethanes P2-ligands, wild-type HIV-1 protease, hydrolase-hydrolase inhibitor complex
Deposited on
2012-01-23, released
2012-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated
2012-03-21, with a file datestamp of
2012-03-16.
Experiment type: XRAY
Resolution: 1.23 Å
R-factor: 0.146
AEROSPACI score: 0.82
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus type 1 [TaxId:11686]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered mutation (6)
- engineered mutation (32)
- engineered mutation (62)
- engineered mutation (66)
- engineered mutation (94)
Domains in SCOPe 2.08: d4dfga_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus type 1 [TaxId:11686]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered mutation (6)
- engineered mutation (32)
- engineered mutation (62)
- engineered mutation (66)
- engineered mutation (94)
Domains in SCOPe 2.08: d4dfgb_ - Heterogens: NA, CL, 0JV, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4dfgA (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4dfgB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf