PDB entry 4dd8

View 4dd8 on RCSB PDB site
Description: ADAM-8 metalloproteinase domain with bound batimastat
Class: hydrolase/hydrolase inhibitor
Keywords: batimastat, inflammation, alpha/beta motif, metalloproteinase, allergic asthma, tumorigenesis, arthritis, aberrant neural cell signaling, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-01-18, released 2012-06-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.192
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disintegrin and metalloproteinase domain-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAM8, MS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4dd8a_
  • Chain 'B':
    Compound: Disintegrin and metalloproteinase domain-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAM8, MS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4dd8b_
  • Chain 'C':
    Compound: Disintegrin and metalloproteinase domain-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAM8, MS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4dd8c_
  • Chain 'D':
    Compound: Disintegrin and metalloproteinase domain-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAM8, MS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4dd8d_
  • Heterogens: BAT, CA, ZN, NA, CL, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dd8A (A:)
    sretryvelyvvvdnaefqmlgseaavrhrvlevvnhvdklyqklnfrvvlvgleiwnsq
    drfhvspdpsvtlenlltwqarqrtrrhlhdnvqlitgvdftgttvgfarvsamcshssg
    avnqdhsknpvgvactmahemghnlgmdhdenvqgcrcqerfeagrcimagsigssfprm
    fsdcsqaylesflerpqsvclanapdls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dd8A (A:)
    retryvelyvvvdnaefqmlgseaavrhrvlevvnhvdklyqklnfrvvlvgleiwnsqd
    rfhvspdpsvtlenlltwqarrhlhdnvqlitgvdftgttvgfarvsamcshssgavnqd
    hsknpvgvactmahemghnlgmdhdenvqgcrcqerfeagrcimagsigssfprmfsdcs
    qaylesflerpqsvclanapd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dd8B (B:)
    sretryvelyvvvdnaefqmlgseaavrhrvlevvnhvdklyqklnfrvvlvgleiwnsq
    drfhvspdpsvtlenlltwqarqrtrrhlhdnvqlitgvdftgttvgfarvsamcshssg
    avnqdhsknpvgvactmahemghnlgmdhdenvqgcrcqerfeagrcimagsigssfprm
    fsdcsqaylesflerpqsvclanapdls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dd8B (B:)
    retryvelyvvvdnaefqmlgseaavrhrvlevvnhvdklyqklnfrvvlvgleiwnsqd
    rfhvspdpsvtlenlltwqarqrtrrhlhdnvqlitgvdftgttvgfarvsamcshssga
    vnqdhsknpvgvactmahemghnlgmdhdenvqgcrcqerfeagrcimagsigssfprmf
    sdcsqaylesflerpqsvclanapd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dd8C (C:)
    sretryvelyvvvdnaefqmlgseaavrhrvlevvnhvdklyqklnfrvvlvgleiwnsq
    drfhvspdpsvtlenlltwqarqrtrrhlhdnvqlitgvdftgttvgfarvsamcshssg
    avnqdhsknpvgvactmahemghnlgmdhdenvqgcrcqerfeagrcimagsigssfprm
    fsdcsqaylesflerpqsvclanapdls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dd8C (C:)
    retryvelyvvvdnaefqmlgseaavrhrvlevvnhvdklyqklnfrvvlvgleiwnsqd
    rfhvspdpsvtlenlltwqarqrhlhdnvqlitgvdftgttvgfarvsamcshssgavnq
    dhsknpvgvactmahemghnlgmdhdenvqgcrcqerfeagrcimagsigssfprmfsdc
    sqaylesflerpqsvclanap
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dd8D (D:)
    sretryvelyvvvdnaefqmlgseaavrhrvlevvnhvdklyqklnfrvvlvgleiwnsq
    drfhvspdpsvtlenlltwqarqrtrrhlhdnvqlitgvdftgttvgfarvsamcshssg
    avnqdhsknpvgvactmahemghnlgmdhdenvqgcrcqerfeagrcimagsigssfprm
    fsdcsqaylesflerpqsvclanapdls