PDB entry 4das

View 4das on RCSB PDB site
Description: Crystal structure of Bullfrog M ferritin
Class: oxidoreductase
Keywords: iron storage protein, 24-subunit maxiferritin, four-helix bundle subunit, oxidoreductase, ferroxidase
Deposited on 2012-01-13, released 2013-01-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.189
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4dasf_
  • Chain 'G':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PGE, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4dasF (F:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dasF (F:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.