PDB entry 4dal

View 4dal on RCSB PDB site
Description: Crystal structure of Putative aldehyde dehydrogenase from Sinorhizobium meliloti 1021
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, OXIDOREDUCTASE
Deposited on 2012-01-12, released 2012-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.187
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative aldehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R02268, SMc01656
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dala_
  • Chain 'B':
    Compound: Putative aldehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R02268, SMc01656
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92ND9 (23-497)
      • expression tag (22)
    Domains in SCOPe 2.07: d4dalb1, d4dalb2
  • Chain 'C':
    Compound: Putative aldehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R02268, SMc01656
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92ND9 (23-497)
      • expression tag (22)
    Domains in SCOPe 2.07: d4dalc1, d4dalc2
  • Chain 'D':
    Compound: Putative aldehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R02268, SMc01656
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92ND9 (23-497)
      • expression tag (22)
    Domains in SCOPe 2.07: d4dald1, d4dald2
  • Chain 'E':
    Compound: Putative aldehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R02268, SMc01656
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92ND9 (23-497)
      • expression tag (22)
    Domains in SCOPe 2.07: d4dale1, d4dale2
  • Chain 'F':
    Compound: Putative aldehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R02268, SMc01656
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92ND9 (23-497)
      • expression tag (22)
    Domains in SCOPe 2.07: d4dalf1, d4dalf2
  • Chain 'G':
    Compound: Putative aldehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R02268, SMc01656
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92ND9 (23-End)
      • expression tag (22)
    Domains in SCOPe 2.07: d4dalg1, d4dalg2
  • Chain 'H':
    Compound: Putative aldehyde dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R02268, SMc01656
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92ND9 (23-497)
      • expression tag (22)
    Domains in SCOPe 2.07: d4dalh1, d4dalh2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dalA (A:)
    mhhhhhhssgvdlgtenlyfqsmmdtqlligsrfeagteaeehilnprtgagiidlaeas
    haqidaavdaaerafvgwsqttpaersnallkiadaiekeadefaalealncgkpinavk
    ndelpaiidcwrffagavrnlhapaageylpghtsmirrdpigivgsiapwnyplmmmaw
    klapaigggntvvfkpseqtpltalklarliadilpegvvnvitgrgetvgnalinhpkv
    gmvsitgdiatgkkvlaaaaktvkrthlelggkapvivygdadleavvngirtfgyynag
    qdctaacriyaeagiyeklvadltsavstirynldddteneigplisrrqrdrvasfver
    aadqkhieittggrtgsdegfffqptvvagatqedeivrrevfgpvvsvtrftgkddava
    wandsdyglassvwtkdiskamraasrlqygctwinthfmltnemphggikqsgygkdms
    vyaledytavrhiminhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dalA (A:)
    mdtqlligsrfeagteaeehilnprtgagiidlaeashaqidaavdaaerafvgwsqttp
    aersnallkiadaiekeadefaalealncgkpinavkndelpaiidcwrffagavrnlha
    paageylpghtsmirrdpigivgsiapwnyplmmmawklapaigggntvvfkpseqtplt
    alklarliadilpegvvnvitgrgetvgnalinhpkvgmvsitgdiatgkkvlaaaaktv
    krthlelggkapvivygdadleavvngirtfgyynagqdctaacriyaeagiyeklvadl
    tsavstirynldddteneigplisrrqrdrvasfveraadqkhieittggrtgsdegfff
    qptvvagatqedeivrrevfgpvvsvtrftgkddavawandsdyglassvwtkdiskamr
    aasrlqygctwinthfmltnemphggikqsgygkdmsvyaledytavrhiminhg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dalB (B:)
    mhhhhhhssgvdlgtenlyfqsmmdtqlligsrfeagteaeehilnprtgagiidlaeas
    haqidaavdaaerafvgwsqttpaersnallkiadaiekeadefaalealncgkpinavk
    ndelpaiidcwrffagavrnlhapaageylpghtsmirrdpigivgsiapwnyplmmmaw
    klapaigggntvvfkpseqtpltalklarliadilpegvvnvitgrgetvgnalinhpkv
    gmvsitgdiatgkkvlaaaaktvkrthlelggkapvivygdadleavvngirtfgyynag
    qdctaacriyaeagiyeklvadltsavstirynldddteneigplisrrqrdrvasfver
    aadqkhieittggrtgsdegfffqptvvagatqedeivrrevfgpvvsvtrftgkddava
    wandsdyglassvwtkdiskamraasrlqygctwinthfmltnemphggikqsgygkdms
    vyaledytavrhiminhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dalB (B:)
    mmdtqlligsrfeagteaeehilnprtgagiidlaeashaqidaavdaaerafvgwsqtt
    paersnallkiadaiekeadefaalealncgkpinavkndelpaiidcwrffagavrnlh
    apaageylpghtsmirrdpigivgsiapwnyplmmmawklapaigggntvvfkpseqtpl
    talklarliadilpegvvnvitgrgetvgnalinhpkvgmvsitgdiatgkkvlaaaakt
    vkrthlelggkapvivygdadleavvngirtfgyynagqdctaacriyaeagiyeklvad
    ltsavstirynldddteneigplisrrqrdrvasfveraadqkhieittggrtgsdegff
    fqptvvagatqedeivrrevfgpvvsvtrftgkddavawandsdyglassvwtkdiskam
    raasrlqygctwinthfmltnemphggikqsgygkdmsvyaledytavrhiminhg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dalC (C:)
    mhhhhhhssgvdlgtenlyfqsmmdtqlligsrfeagteaeehilnprtgagiidlaeas
    haqidaavdaaerafvgwsqttpaersnallkiadaiekeadefaalealncgkpinavk
    ndelpaiidcwrffagavrnlhapaageylpghtsmirrdpigivgsiapwnyplmmmaw
    klapaigggntvvfkpseqtpltalklarliadilpegvvnvitgrgetvgnalinhpkv
    gmvsitgdiatgkkvlaaaaktvkrthlelggkapvivygdadleavvngirtfgyynag
    qdctaacriyaeagiyeklvadltsavstirynldddteneigplisrrqrdrvasfver
    aadqkhieittggrtgsdegfffqptvvagatqedeivrrevfgpvvsvtrftgkddava
    wandsdyglassvwtkdiskamraasrlqygctwinthfmltnemphggikqsgygkdms
    vyaledytavrhiminhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dalC (C:)
    mmdtqlligsrfeagteaeehilnprtgagiidlaeashaqidaavdaaerafvgwsqtt
    paersnallkiadaiekeadefaalealncgkpinavkndelpaiidcwrffagavrnlh
    apaageylpghtsmirrdpigivgsiapwnyplmmmawklapaigggntvvfkpseqtpl
    talklarliadilpegvvnvitgrgetvgnalinhpkvgmvsitgdiatgkkvlaaaakt
    vkrthlelggkapvivygdadleavvngirtfgyynagqdctaacriyaeagiyeklvad
    ltsavstirynldddteneigplisrrqrdrvasfveraadqkhieittggrtgsdegff
    fqptvvagatqedeivrrevfgpvvsvtrftgkddavawandsdyglassvwtkdiskam
    raasrlqygctwinthfmltnemphggikqsgygkdmsvyaledytavrhiminhg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4dalD (D:)
    mhhhhhhssgvdlgtenlyfqsmmdtqlligsrfeagteaeehilnprtgagiidlaeas
    haqidaavdaaerafvgwsqttpaersnallkiadaiekeadefaalealncgkpinavk
    ndelpaiidcwrffagavrnlhapaageylpghtsmirrdpigivgsiapwnyplmmmaw
    klapaigggntvvfkpseqtpltalklarliadilpegvvnvitgrgetvgnalinhpkv
    gmvsitgdiatgkkvlaaaaktvkrthlelggkapvivygdadleavvngirtfgyynag
    qdctaacriyaeagiyeklvadltsavstirynldddteneigplisrrqrdrvasfver
    aadqkhieittggrtgsdegfffqptvvagatqedeivrrevfgpvvsvtrftgkddava
    wandsdyglassvwtkdiskamraasrlqygctwinthfmltnemphggikqsgygkdms
    vyaledytavrhiminhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dalD (D:)
    mmdtqlligsrfeagteaeehilnprtgagiidlaeashaqidaavdaaerafvgwsqtt
    paersnallkiadaiekeadefaalealncgkpinavkndelpaiidcwrffagavrnlh
    apaageylpghtsmirrdpigivgsiapwnyplmmmawklapaigggntvvfkpseqtpl
    talklarliadilpegvvnvitgrgetvgnalinhpkvgmvsitgdiatgkkvlaaaakt
    vkrthlelggkapvivygdadleavvngirtfgyynagqdctaacriyaeagiyeklvad
    ltsavstirynldddteneigplisrrqrdrvasfveraadqkhieittggrtgsdegff
    fqptvvagatqedeivrrevfgpvvsvtrftgkddavawandsdyglassvwtkdiskam
    raasrlqygctwinthfmltnemphggikqsgygkdmsvyaledytavrhiminhg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4dalE (E:)
    mhhhhhhssgvdlgtenlyfqsmmdtqlligsrfeagteaeehilnprtgagiidlaeas
    haqidaavdaaerafvgwsqttpaersnallkiadaiekeadefaalealncgkpinavk
    ndelpaiidcwrffagavrnlhapaageylpghtsmirrdpigivgsiapwnyplmmmaw
    klapaigggntvvfkpseqtpltalklarliadilpegvvnvitgrgetvgnalinhpkv
    gmvsitgdiatgkkvlaaaaktvkrthlelggkapvivygdadleavvngirtfgyynag
    qdctaacriyaeagiyeklvadltsavstirynldddteneigplisrrqrdrvasfver
    aadqkhieittggrtgsdegfffqptvvagatqedeivrrevfgpvvsvtrftgkddava
    wandsdyglassvwtkdiskamraasrlqygctwinthfmltnemphggikqsgygkdms
    vyaledytavrhiminhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dalE (E:)
    mmdtqlligsrfeagteaeehilnprtgagiidlaeashaqidaavdaaerafvgwsqtt
    paersnallkiadaiekeadefaalealncgkpinavkndelpaiidcwrffagavrnlh
    apaageylpghtsmirrdpigivgsiapwnyplmmmawklapaigggntvvfkpseqtpl
    talklarliadilpegvvnvitgrgetvgnalinhpkvgmvsitgdiatgkkvlaaaakt
    vkrthlelggkapvivygdadleavvngirtfgyynagqdctaacriyaeagiyeklvad
    ltsavstirynldddteneigplisrrqrdrvasfveraadqkhieittggrtgsdegff
    fqptvvagatqedeivrrevfgpvvsvtrftgkddavawandsdyglassvwtkdiskam
    raasrlqygctwinthfmltnemphggikqsgygkdmsvyaledytavrhiminhg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4dalF (F:)
    mhhhhhhssgvdlgtenlyfqsmmdtqlligsrfeagteaeehilnprtgagiidlaeas
    haqidaavdaaerafvgwsqttpaersnallkiadaiekeadefaalealncgkpinavk
    ndelpaiidcwrffagavrnlhapaageylpghtsmirrdpigivgsiapwnyplmmmaw
    klapaigggntvvfkpseqtpltalklarliadilpegvvnvitgrgetvgnalinhpkv
    gmvsitgdiatgkkvlaaaaktvkrthlelggkapvivygdadleavvngirtfgyynag
    qdctaacriyaeagiyeklvadltsavstirynldddteneigplisrrqrdrvasfver
    aadqkhieittggrtgsdegfffqptvvagatqedeivrrevfgpvvsvtrftgkddava
    wandsdyglassvwtkdiskamraasrlqygctwinthfmltnemphggikqsgygkdms
    vyaledytavrhiminhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dalF (F:)
    mmdtqlligsrfeagteaeehilnprtgagiidlaeashaqidaavdaaerafvgwsqtt
    paersnallkiadaiekeadefaalealncgkpinavkndelpaiidcwrffagavrnlh
    apaageylpghtsmirrdpigivgsiapwnyplmmmawklapaigggntvvfkpseqtpl
    talklarliadilpegvvnvitgrgetvgnalinhpkvgmvsitgdiatgkkvlaaaakt
    vkrthlelggkapvivygdadleavvngirtfgyynagqdctaacriyaeagiyeklvad
    ltsavstirynldddteneigplisrrqrdrvasfveraadqkhieittggrtgsdegff
    fqptvvagatqedeivrrevfgpvvsvtrftgkddavawandsdyglassvwtkdiskam
    raasrlqygctwinthfmltnemphggikqsgygkdmsvyaledytavrhiminhg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4dalG (G:)
    mhhhhhhssgvdlgtenlyfqsmmdtqlligsrfeagteaeehilnprtgagiidlaeas
    haqidaavdaaerafvgwsqttpaersnallkiadaiekeadefaalealncgkpinavk
    ndelpaiidcwrffagavrnlhapaageylpghtsmirrdpigivgsiapwnyplmmmaw
    klapaigggntvvfkpseqtpltalklarliadilpegvvnvitgrgetvgnalinhpkv
    gmvsitgdiatgkkvlaaaaktvkrthlelggkapvivygdadleavvngirtfgyynag
    qdctaacriyaeagiyeklvadltsavstirynldddteneigplisrrqrdrvasfver
    aadqkhieittggrtgsdegfffqptvvagatqedeivrrevfgpvvsvtrftgkddava
    wandsdyglassvwtkdiskamraasrlqygctwinthfmltnemphggikqsgygkdms
    vyaledytavrhiminhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dalG (G:)
    mmdtqlligsrfeagteaeehilnprtgagiidlaeashaqidaavdaaerafvgwsqtt
    paersnallkiadaiekeadefaalealncgkpinavkndelpaiidcwrffagavrnlh
    apaageylpghtsmirrdpigivgsiapwnyplmmmawklapaigggntvvfkpseqtpl
    talklarliadilpegvvnvitgrgetvgnalinhpkvgmvsitgdiatgkkvlaaaakt
    vkrthlelggkapvivygdadleavvngirtfgyynagqdctaacriyaeagiyeklvad
    ltsavstirynldddteneigplisrrqrdrvasfveraadqkhieittggrtgsdegff
    fqptvvagatqedeivrrevfgpvvsvtrftgkddavawandsdyglassvwtkdiskam
    raasrlqygctwinthfmltnemphggikqsgygkdmsvyaledytavrhiminh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4dalH (H:)
    mhhhhhhssgvdlgtenlyfqsmmdtqlligsrfeagteaeehilnprtgagiidlaeas
    haqidaavdaaerafvgwsqttpaersnallkiadaiekeadefaalealncgkpinavk
    ndelpaiidcwrffagavrnlhapaageylpghtsmirrdpigivgsiapwnyplmmmaw
    klapaigggntvvfkpseqtpltalklarliadilpegvvnvitgrgetvgnalinhpkv
    gmvsitgdiatgkkvlaaaaktvkrthlelggkapvivygdadleavvngirtfgyynag
    qdctaacriyaeagiyeklvadltsavstirynldddteneigplisrrqrdrvasfver
    aadqkhieittggrtgsdegfffqptvvagatqedeivrrevfgpvvsvtrftgkddava
    wandsdyglassvwtkdiskamraasrlqygctwinthfmltnemphggikqsgygkdms
    vyaledytavrhiminhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dalH (H:)
    mmdtqlligsrfeagteaeehilnprtgagiidlaeashaqidaavdaaerafvgwsqtt
    paersnallkiadaiekeadefaalealncgkpinavkndelpaiidcwrffagavrnlh
    apaageylpghtsmirrdpigivgsiapwnyplmmmawklapaigggntvvfkpseqtpl
    talklarliadilpegvvnvitgrgetvgnalinhpkvgmvsitgdiatgkkvlaaaakt
    vkrthlelggkapvivygdadleavvngirtfgyynagqdctaacriyaeagiyeklvad
    ltsavstirynldddteneigplisrrqrdrvasfveraadqkhieittggrtgsdegff
    fqptvvagatqedeivrrevfgpvvsvtrftgkddavawandsdyglassvwtkdiskam
    raasrlqygctwinthfmltnemphggikqsgygkdmsvyaledytavrhiminhg