PDB entry 4d9q

View 4d9q on RCSB PDB site
Description: Inhibiting Alternative Pathway Complement Activation by Targeting the Exosite on Factor D
Class: hydrolase/immune system
Keywords: Factor D, complement, antibody, exosite, Fab, chymotrypsin, protease, HYDROLASE-IMMUNE SYSTEM complex
Deposited on 2012-01-11, released 2012-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: factor d
    Species: Macaca mulatta [TaxId:9544]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F6YBP7 (0-227)
      • conflict (30)
    Domains in SCOPe 2.07: d4d9qa_
  • Chain 'B':
    Compound: factor d
    Species: Macaca mulatta [TaxId:9544]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F6YBP7 (0-227)
      • conflict (30)
    Domains in SCOPe 2.07: d4d9qb_
  • Chain 'D':
    Compound: Anti-Factor D, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4D9Q (0-103)
    • Uniprot Q8TCD0 (104-212)
    Domains in SCOPe 2.07: d4d9qd1, d4d9qd2
  • Chain 'E':
    Compound: Anti-Factor D, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • PDB 4D9Q (0-136)
    • Uniprot P01857 (137-216)
  • Chain 'H':
    Compound: Anti-Factor D, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • PDB 4D9Q (0-136)
    • Uniprot P01857 (137-End)
  • Chain 'L':
    Compound: Anti-Factor D, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4D9Q (0-103)
    • Uniprot Q8TCD0 (104-212)
    Domains in SCOPe 2.07: d4d9ql1, d4d9ql2
  • Heterogens: GOL, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4d9qA (A:)
    ilggreaeaharpymasvqvngehlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsrpdtidhdllllqlsekatlgpavrplpwqrvdrdvepg
    tlcdvagwgivshagrrpdrlqhvllpvldratcnrrthhdgaitqrmmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4d9qB (B:)
    ilggreaeaharpymasvqvngehlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsrpdtidhdllllqlsekatlgpavrplpwqrvdrdvepg
    tlcdvagwgivshagrrpdrlqhvllpvldratcnrrthhdgaitqrmmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4d9qD (D:)
    diqvtqspsslsasvgdrvtitcitstdidddmnwyqqkpgkvpkllisggntlrpgvps
    rfsgsgsgtdftltisslqpedvatyyclqsdslpytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'E':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4d9qL (L:)
    diqvtqspsslsasvgdrvtitcitstdidddmnwyqqkpgkvpkllisggntlrpgvps
    rfsgsgsgtdftltisslqpedvatyyclqsdslpytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge