PDB entry 4d8k

View 4d8k on RCSB PDB site
Description: Crystal structure of a SH3-SH2 domains of a lymphocyte-specific protein tyrosine kinase (LCK) from Homo sapiens at 2.36 A resolution
Class: transferase
Keywords: Protein kinases, SH2 domain, SH3 domain, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, Partnership for T-Cell Biology, TCELL, TRANSFERASE
Deposited on 2012-01-10, released 2012-01-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.194
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase Lck
    Species: Homo sapiens [TaxId:9606]
    Gene: BC013200, LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d8ka1, d4d8ka2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d8kA (A:)
    ggsnppasplqdnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfi
    pfnfvakanslepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfd
    qnqgevvkhykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d8kA (A:)
    nlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvakansle
    pepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyki
    rnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt