PDB entry 4d7y

View 4d7y on RCSB PDB site
Description: Crystal structure of mouse C1QL1 globular domain
Class: signaling protein
Keywords: signaling protein
Deposited on 2014-12-01, released 2015-01-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.1415
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c1q-related factor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4d7ya_
  • Heterogens: CD, NI, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d7yA (A:)
    etgttvprvafyaglknphegyevlkfddvvtnlgnnydaasgkftcnipgtyfftyhvl
    mrggdgtsmwadlckngqvrasaiaqdadqnydyasnsvilhldagdevfikldggkahg
    gnsnkystfsgfiiysdgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d7yA (A:)
    prvafyaglknphegyevlkfddvvtnlgnnydaasgkftcnipgtyfftyhvlmrggdg
    tsmwadlckngqvrasaiaqdadqnydyasnsvilhldagdevfikldggkahggnsnky
    stfsgfiiysd