PDB entry 4d7s

View 4d7s on RCSB PDB site
Description: structure of the sthk carboxy-terminal region in complex with cgmp
Class: transport protein
Keywords: transport protein
Deposited on 2014-11-27, released 2015-02-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.2049
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sthk_cnbd_cgmp
    Species: SPIROCHAETA THERMOPHILA DSM 6192 [TaxId:665571]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4d7sa_
  • Chain 'B':
    Compound: sthk_cnbd_cgmp
    Species: SPIROCHAETA THERMOPHILA DSM 6192 [TaxId:665571]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4d7sb_
  • Heterogens: PCG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d7sA (A:)
    daakllhrermervtaflsykkispelqrrileyfdylwetrrgyeerevlkelphplrl
    avameihgdviekvplfkgagedfirdiilhlepviygpgeyiiragelgsdvyfinrgs
    vevlsadektryailsegqffgemalilraprtatvrartfcdlyrldketfdrilsryp
    eiaaqiqelavrrkeele
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d7sA (A:)
    daakllhrermervtaflsykkispelqrrileyfdylwetrrgyeerevlkelphplrl
    avameihgdviekvplfkgagedfirdiilhlepviygpgeyiiragelgsdvyfinrgs
    vevlsadektryailsegqffgemalilraprtatvrartfcdlyrldketfdrilsryp
    eiaaqiqelavrrkeel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4d7sB (B:)
    daakllhrermervtaflsykkispelqrrileyfdylwetrrgyeerevlkelphplrl
    avameihgdviekvplfkgagedfirdiilhlepviygpgeyiiragelgsdvyfinrgs
    vevlsadektryailsegqffgemalilraprtatvrartfcdlyrldketfdrilsryp
    eiaaqiqelavrrkeele
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d7sB (B:)
    hrermervtaflsykkispelqrrileyfdylwetrrgyeerevlkelphplrlavamei
    hgdviekvplfkgagedfirdiilhlepviygpgeyiiragelgsdvyfinrgsvevlsa
    dektryailsegqffgemalilraprtatvrartfcdlyrldketfdrilsrypeiaaqi
    qelavrrkeel